Details for Lyrate rockcress Locus 16039854

Position : sca3 ( 5`- 6552219 .. 6553493 -3` )
Annotation : [B2G] indoleacetic acid-induced protein 19
External links : CoGe
PGDD synteny : 16039854

Protein [Map View]
MEKEGLGLEITELRLGLPGRDVAEKMIKKRAFTEMNMTSSGSNSDQCESGVVSSGGDVEKVNDSPAAKSQVVGWPPVCSY
RRKNSCKEAATTKVGLGYVKVSMDGVPYLRKMDLGSSQDYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWM
LAGDVPWGMFIESCKRLRIMRRSDASGFGLQPRGVDE*

DNA
ATGGAGAAGGAAGGACTCGGGCTTGAGATAACGGAGCTGAGATTGGGGCTTCCGGGGAGAGATGTGGCTGAGAAGATGAT
AAAGAAGAGAGCTTTCACGGAGATGAACATGACGTCTTCTGGTAGTAATAGTGATCAATGTGAAAGCGGTGTCGTTTCAT
CTGGTGGTGACGTTGAGAAGGTTAATGATTCGCCGGCGGCGAAAAGTCAGGTGGTGGGGTGGCCGCCGGTTTGCTCTTAC
CGTAGGAAAAACAGCTGTAAGGAAGCTGCGACCACAAAAGTGGGTTTAGGGTATGTGAAAGTTAGCATGGATGGTGTGCC
TTATTTGAGGAAGATGGATCTTGGTTCGAGCCAAGACTATGATGATCTAGCCTTTGCTCTTGACAAGCTCTTCGGTTTCC
GTGGCATCGGTGTTGCCTTGAAAGATGGTGACAACTGCGAATACGTTACCATATACGAGGACAAAGATGGAGATTGGATG
CTCGCCGGCGATGTACCTTGGGGGATGTTTATTGAGTCATGCAAGAGGCTGAGGATAATGAGAAGATCGGATGCTTCCGG
GTTTGGGCTGCAGCCTAGAGGCGTAGACGAGTGA