Details for Lyrate rockcress Locus 16039793

Position : sca3 ( 5`- 11014720 .. 11017025 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039793

Protein [Map View]
MNSNIFPPSKHQNQFNIQQSFSNLQSQCSNLLHNVSQTLNPLFNPNKNNNRNIFSALNSLRDQAKQALDSRISRFNSGKA
PVWARISDDVGGGGGARTQVTAPVRGSGKGLTADAIEERLAGVPVYALSNSNEEFVLVSGTSSGKSLGLLFCKEEDAETL
LKQMKSMDPRMRKEGSKVVALALSKVFQLKVNGVAFRLIPESTQVKNALKERKTAGIDDDDFHGVPVFQSKSLILRSENM
SYRPVFFRKEDLEKSLIRASSQQNRLNPALKPGDIQVAVFEDIVKGMKESTTSNWDDIVFIPPGFEVSTEQTQE*

DNA
ATGAATTCAAACATTTTCCCACCATCGAAACATCAAAACCAGTTTAACATACAACAATCCTTCTCAAATCTCCAATCTCA
ATGCTCCAATTTACTCCACAACGTTTCGCAAACCCTTAATCCTCTCTTCAACCCCAACAAGAACAACAACCGTAATATCT
TCTCTGCTCTCAATTCGTTGCGTGATCAAGCTAAGCAAGCTTTAGATTCTAGAATCTCTCGTTTCAATTCTGGTAAGGCA
CCAGTTTGGGCGAGAATTTCTGACGACGTCGGTGGCGGTGGTGGTGCGAGGACTCAGGTGACGGCTCCGGTTCGCGGAAG
CGGGAAAGGATTAACGGCTGATGCTATTGAGGAGAGATTGGCGGGAGTTCCTGTTTACGCGTTGAGTAATTCGAACGAGG
AGTTTGTGTTGGTTTCAGGGACTTCTTCTGGGAAATCTCTGGGTTTGTTGTTTTGTAAAGAGGAAGATGCAGAGACACTT
CTTAAACAGATGAAGAGTATGGATCCTCGTATGAGGAAAGAAGGTTCAAAAGTTGTTGCTCTTGCTCTTAGCAAGGTGTT
CCAGTTAAAAGTTAATGGTGTGGCATTTAGGTTGATTCCTGAGTCTACTCAAGTGAAAAATGCCTTGAAGGAAAGGAAAA
CAGCTGGTATTGATGATGATGACTTCCATGGTGTTCCAGTTTTCCAGTCAAAGAGCTTGATTCTACGAAGTGAAAACATG
AGTTATCGCCCTGTTTTCTTCAGAAAGGAGGACTTGGAAAAATCCCTAATACGAGCGTCCAGCCAACAGAACCGACTCAA
CCCTGCTCTGAAACCAGGCGATATTCAGGTTGCAGTTTTCGAAGATATTGTCAAGGGAATGAAGGAAAGCACGACATCAA
ACTGGGACGACATTGTCTTTATACCGCCTGGTTTTGAGGTTTCAACTGAGCAAACCCAGGAGTAG