Details for Lyrate rockcress Locus 16039747

Position : sca3 ( 5`- 3476870 .. 3475616 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039747

Protein [Map View]
MSYPERKRKKTRWSTPHSTPNPSLPDDLLLSIFARVSRLYYPTLSLSFRSLLASPELYKARSLSANTESCLYVCLRCCSG
YRWFTLCRKPDQTITNNKERKSSGYALARVPIPGGSPNVRSSSLVAVGSDIYNICGSINKASPSSSVSILDCRSHKWREA
PSLPVELCSVSASVLDQKIYVAGCYNQVQGNGYPDSRKNSFEVGSEVAYNSKEGRWDSKELGMGGFMFSDSYCEIDNVLY
SLSDGAFRWYDTEVREWKDLNGLFQLPKFSASACVRLADYGGKMAVLWDQLPYHYGYQKEIHCAVVERPTRYEMWGKSCE
IWGKVEWCDLMLTVPTSYVLVKVLAATL*

DNA
ATGTCTTACCCGGAAAGAAAGAGGAAGAAGACACGGTGGTCAACGCCGCATTCGACTCCAAACCCGTCACTTCCCGATGA
TTTGCTATTGAGCATCTTCGCACGCGTGTCAAGATTATACTATCCTACTCTCTCACTCAGCTTTCGATCTCTCCTAGCTT
CACCAGAGCTTTACAAGGCCAGGTCACTCTCGGCAAACACCGAGAGTTGTCTCTATGTATGCTTACGGTGCTGTTCTGGT
TATCGCTGGTTCACCCTCTGCCGTAAACCTGATCAAACCATAACCAATAATAAGGAGAGGAAGTCAAGTGGTTATGCTTT
GGCTAGAGTCCCAATTCCCGGTGGTTCTCCTAATGTACGATCTTCGAGTCTCGTGGCCGTTGGTTCTGATATCTACAACA
TTTGCGGATCCATCAACAAAGCGTCCCCCTCCTCTAGCGTCTCGATTCTGGATTGCCGGTCTCACAAGTGGCGAGAGGCT
CCAAGCTTGCCGGTGGAGCTATGTTCAGTTTCTGCTAGCGTCCTTGATCAAAAGATATATGTAGCAGGATGCTACAACCA
AGTTCAAGGTAATGGCTATCCTGATTCCCGGAAAAACTCCTTTGAGGTAGGAAGTGAGGTTGCTTACAATTCCAAGGAAG
GTAGATGGGATTCCAAGGAACTTGGGATGGGTGGTTTTATGTTTTCAGATTCTTATTGCGAGATAGATAACGTTTTGTAC
TCTTTATCCGATGGAGCGTTCAGATGGTATGACACTGAGGTAAGAGAGTGGAAAGATTTGAATGGTTTGTTTCAGCTGCC
TAAGTTCTCTGCTAGTGCTTGTGTTAGATTGGCTGATTATGGTGGAAAGATGGCGGTCTTGTGGGACCAATTGCCTTATC
ATTATGGCTATCAAAAGGAGATTCATTGTGCGGTGGTTGAAAGGCCCACAAGATATGAAATGTGGGGGAAAAGTTGTGAA
ATTTGGGGGAAAGTTGAGTGGTGTGATCTTATGCTTACAGTCCCTACATCGTATGTTCTTGTTAAGGTTCTTGCTGCTAC
GCTTTGA