Details for Lyrate rockcress Locus 16039729

Position : sca3 ( 5`- 5153581 .. 5154632 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039729

Protein [Map View]
MASSLPQFYADFTTFSGETSSQFHGSSSCPDVDSSLSSYLDDCYGSFNTSSNPESIFVPQVFGISDVSVPEYNNYYQKMS
VNNATQYFHGGDHQEYYAFSPEIKPLFRPATGEQSWGNSEGGIQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIK
YVCRKTLADRRVRVRGRFARNNDTCEEQSHMSKNHNNHSEKEEDMFSGSDDYLIQMEHDDGWLHEAMSNLIPFPCEFDAP
GDAHHPNTWSF*

DNA
ATGGCATCATCTCTTCCTCAGTTCTACGCTGATTTCACAACATTTTCCGGTGAGACTTCTTCGCAGTTTCACGGCTCTTC
TTCATGTCCCGACGTGGACTCCTCGTTATCCAGCTACCTTGACGACTGTTATGGCTCCTTCAATACCTCTTCTAATCCAG
AATCCATCTTTGTACCCCAAGTTTTTGGTATTTCTGACGTCTCTGTGCCTGAATACAACAATTATTACCAGAAAATGAGT
GTGAATAATGCCACACAATACTTTCATGGTGGGGATCATCAAGAATACTACGCCTTTTCACCGGAGATCAAGCCCTTGTT
CCGTCCGGCCACAGGAGAGCAATCTTGGGGAAATAGTGAAGGAGGGATACAGGCTGAGCCAAACACAAAAGTGGGACGCT
ATTCGGTTGAAGAACGTAAAGACAGAATCATGAGGTACTTGAAGAAGAAGAACCAGCGCAACTTCAATAAGACCATCAAG
TATGTGTGTCGTAAAACCCTAGCCGACCGACGTGTTCGTGTTCGCGGCCGATTTGCTAGAAATAATGACACATGTGAAGA
ACAATCTCACATGTCAAAGAATCACAACAACCATTCTGAAAAAGAGGAAGATATGTTTTCAGGATCAGACGACTATCTAA
TCCAGATGGAACACGATGACGGATGGCTTCACGAAGCAATGTCTAATCTGATTCCTTTTCCTTGTGAATTTGACGCTCCT
GGAGATGCTCATCATCCAAACACTTGGAGTTTCTGA