Details for Lyrate rockcress Locus 16039720

Position : sca3 ( 5`- 7877647 .. 7876817 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039720

Protein [Map View]
MSSTFNDYHHHPKREPNENNSGILYTPSPSPSPSPPTLKVNKDSHVIKKPPSPSSSSSAAKPRHPVIIYTHTPRIIHTNP
KDFMALVQKLTGMSRSDEDPGGNATTDPGGKSINRTVSDLTVDRKNNRNRCGGGGGNNNYNRSFSGTGAGTGNGKGIFFN
NTMISEDSESSSVITTDENIGEHGQVNSSLPYSAVAIPPQPPPHPPPPPSMYDAAGINYGAYLPIFPPANPTDNFLCGNQ
PFANFDDPLFFAPNMRSSFSSSSSSGFDGLTEFRDF*

DNA
ATGAGCTCAACGTTTAACGACTACCATCACCATCCAAAGAGAGAACCAAATGAAAACAACTCCGGAATCTTATACACTCC
CTCACCGTCACCGTCACCGTCACCGCCGACGTTAAAAGTCAACAAAGACTCTCACGTTATTAAAAAACCTCCGTCTCCGT
CGTCTTCCTCCTCCGCGGCGAAGCCTCGTCACCCGGTGATCATTTACACACACACTCCCAGAATCATACACACTAATCCT
AAAGATTTCATGGCTCTTGTTCAAAAACTCACCGGAATGTCCCGCTCCGACGAAGATCCCGGCGGTAACGCAACGACAGA
TCCCGGGGGAAAATCAATCAACCGGACTGTCTCTGATCTAACCGTCGACAGAAAAAATAATCGGAATCGTTGCGGCGGAG
GTGGTGGCAATAATAACTACAACAGAAGCTTCTCCGGTACCGGAGCCGGAACCGGAAACGGAAAGGGGATATTTTTTAAT
AACACGATGATAAGTGAAGATAGTGAATCGTCGTCAGTGATAACAACTGATGAGAACATCGGAGAACATGGACAGGTTAA
TTCTTCTCTTCCGTATTCGGCGGTGGCTATTCCTCCACAGCCACCGCCTCATCCTCCTCCGCCACCGTCAATGTACGACG
CGGCGGGGATAAACTACGGTGCTTATTTACCGATTTTCCCGCCGGCGAATCCAACTGATAATTTCTTATGCGGTAATCAG
CCGTTTGCGAATTTTGATGATCCGCTTTTCTTCGCGCCTAATATGAGAAGCTCTTTCTCTTCTTCTTCATCTTCTGGCTT
CGATGGCTTGACGGAGTTTCGCGATTTTTAA