Details for Lyrate rockcress Locus 16039675

Position : sca3 ( 5`- 647151 .. 644572 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039675

Protein [Map View]
MVSATSIIAWGSGEDGQLGIGTNEEKEWACVVEALEPYSVRSVVSGSRNSLAICDDGTMFTWGWNQRGTLGHPPETKTEN
IPSRVKALANVKITQAAIGGWHCLAVDDQGRAYAWGGNEYGQCGEEPLKDEMGRPVRRDIVIPKRCAPKLTVRQVAAGGT
HSVVLTREGHVWTWGQPWPPGDIKQIFVPVRVQGLENVSIIAVGAFHNLALEEDGRLLAWGNNEYGQLGTGDTQPTSHPV
PVHGLDDLTLVDIAAGGWHSTALTDKGEVYGWGRGEHGRLGFGDNDKSSKMVPQKVNLLAEEDIIQVSCGGTHSVALTRD
GRIFSFGRGDHGRLGYGRKVTTGQPLELPIMIPPPEGSFNHADEEEEGKWSAKWIACGGRHTLAIVEWKSDDI*

DNA
ATGGTTTCAGCTACTTCAATCATAGCCTGGGGTTCTGGAGAAGATGGGCAACTAGGAATTGGTACCAACGAAGAAAAGGA
ATGGGCTTGCGTCGTTGAAGCTCTCGAGCCTTACTCTGTTCGCTCAGTTGTCTCTGGTAGCCGGAACTCCCTCGCCATTT
GCGATGATGGCACGATGTTTACATGGGGTTGGAATCAAAGAGGTACATTAGGACACCCACCAGAAACAAAAACAGAGAAC
ATCCCTAGTCGAGTTAAAGCCCTTGCCAATGTCAAGATCACTCAGGCAGCAATTGGTGGTTGGCATTGTTTAGCTGTTGA
TGATCAAGGCCGAGCATATGCGTGGGGTGGGAATGAATATGGACAATGTGGTGAAGAGCCTTTAAAAGACGAGATGGGTA
GGCCCGTACGGAGAGATATTGTGATCCCTAAGCGTTGTGCCCCGAAACTTACAGTTCGTCAGGTAGCTGCAGGTGGTACT
CACTCGGTGGTTCTGACACGCGAAGGTCATGTGTGGACTTGGGGTCAACCGTGGCCTCCCGGAGACATAAAACAAATATT
TGTTCCTGTGAGAGTTCAAGGTCTTGAAAATGTCAGTATTATCGCTGTTGGAGCATTTCATAATCTGGCTCTTGAAGAAG
ATGGGAGATTATTGGCATGGGGTAATAACGAATACGGACAACTTGGAACCGGTGACACCCAGCCAACATCTCATCCTGTT
CCAGTCCATGGCCTCGATGATCTCACTTTGGTTGATATTGCTGCGGGTGGATGGCACTCAACGGCTTTAACTGATAAAGG
AGAGGTGTATGGTTGGGGAAGAGGAGAACACGGAAGACTCGGGTTTGGTGACAATGACAAGAGCAGCAAAATGGTTCCAC
AGAAAGTTAATCTTCTAGCTGAAGAAGATATAATTCAGGTTTCTTGTGGTGGAACACATTCAGTTGCTTTGACAAGAGAT
GGCAGAATCTTCTCGTTTGGTAGAGGAGATCATGGTAGACTTGGTTATGGAAGGAAAGTAACCACAGGACAGCCATTGGA
GTTACCTATAATGATTCCTCCGCCTGAAGGAAGCTTTAATCACGCAGACGAAGAAGAAGAAGGAAAATGGTCAGCTAAAT
GGATCGCTTGCGGTGGCCGCCACACTCTTGCCATTGTAGAATGGAAGTCCGATGATATTTGA