Details for Lyrate rockcress Locus 16039645

Position : sca3 ( 5`- 2170066 .. 2168653 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039645

Protein [Map View]
MEPRDNQAEASYTFGDRSSSDIVVRLRNEEGRDDWIYCHSKILSQKSQYFADRLSDKWPTCKILDSRYCVEVICQESDYD
HHINLLRLLYLVSDGVHEDNLCHNVKSALGILCVAKELCCPQIVTACVNYLEAVPWEEGEEEEILRTVPRIGSEAEPILA
RLQPVDQSAVTEIFVSAFRFATSSPPLPLGDIKSSAQEQIEYMITEDDDAPLLIADEEVKLEVNECVKSLFGRFFQCLEE
TSFKPVESEVINKKGSFRMVLSDLSWAFQILTKMEVVRDFVITWVDISEKLVKVVEQLETTVAETVEIRVKVIEVTAKVI
EAIGYGTVILPTAKRLEMVKLWLPFVRNTKPLVDSPVTEDEENGTVRYKIDGEIWQALESSFVSIILALPSADQAEILTE
WLGKNGLYPDLTEAFEVWCYRSKVAKRRLGLLGGEEDENGMS*

DNA
ATGGAGCCTCGTGATAATCAAGCCGAGGCTTCATATACATTTGGTGATCGATCGAGCAGTGACATAGTTGTTAGACTTAG
AAACGAAGAAGGCCGTGATGATTGGATCTATTGCCATTCCAAGATCCTTAGTCAGAAAAGCCAGTATTTCGCTGACCGCC
TCTCTGATAAATGGCCCACTTGCAAGATTCTTGATTCACGCTACTGTGTTGAGGTCATCTGTCAAGAATCAGACTATGAT
CATCATATCAATCTCTTAAGACTTCTCTATCTTGTCTCTGATGGTGTCCATGAGGATAACTTGTGTCATAATGTGAAAAG
TGCGTTGGGGATTCTCTGTGTCGCTAAAGAACTTTGTTGCCCTCAGATTGTCACTGCTTGTGTGAACTACTTGGAAGCTG
TTCCATGGGAAGAAGGCGAAGAGGAAGAGATTCTGCGGACTGTACCGAGAATTGGATCAGAAGCAGAGCCGATTCTTGCC
CGTCTCCAACCAGTTGATCAGTCCGCTGTTACTGAAATCTTTGTATCGGCTTTTAGGTTTGCTACTTCGTCCCCGCCTTT
GCCCTTGGGTGACATAAAATCCTCGGCTCAAGAACAGATTGAGTATATGATAACCGAAGATGACGATGCACCGTTGTTGA
TTGCTGATGAAGAAGTCAAGCTTGAAGTAAATGAATGTGTAAAGAGCCTGTTTGGTAGATTCTTCCAATGTCTAGAAGAA
ACCTCTTTCAAACCCGTCGAGTCTGAGGTTATTAACAAAAAGGGGTCTTTTAGGATGGTTCTTTCAGATTTGTCGTGGGC
TTTTCAGATATTAACAAAGATGGAAGTGGTTAGAGATTTTGTTATAACATGGGTTGACATATCTGAGAAGTTAGTTAAGG
TAGTTGAGCAGTTGGAAACAACAGTTGCAGAGACTGTTGAGATAAGAGTCAAGGTCATTGAGGTGACTGCAAAAGTCATA
GAGGCCATCGGTTATGGAACAGTGATATTGCCAACAGCGAAAAGGCTTGAGATGGTAAAACTATGGCTTCCATTTGTAAG
AAACACAAAGCCACTTGTTGACTCACCGGTTACTGAAGATGAGGAGAATGGTACTGTGAGATATAAAATTGATGGAGAGA
TATGGCAAGCTTTAGAATCTTCCTTTGTATCGATAATTCTGGCATTGCCATCTGCAGACCAAGCTGAGATATTAACTGAA
TGGTTAGGCAAGAACGGGTTGTATCCGGATTTGACAGAAGCTTTCGAGGTTTGGTGTTACAGATCAAAAGTCGCAAAGAG
AAGATTGGGTTTGCTCGGGGGCGAGGAAGATGAGAACGGTATGTCTTAA