Details for Lyrate rockcress Locus 16039631

Position : sca3 ( 5`- 4011329 .. 4010115 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039631

Protein [Map View]
MPQNPQNPVQFQHPHPYTTSGDQQTQPPMKSLYPYASKPKQLSPISGAGDDEDRGSGSGSGCNPEDSAGTDGKRKLSQWH
RMKWTDTMVRLLIMAVFYIGDEAGLNDPIDPKKKTGGGGGGGMLQKKGKWKSVSRAMVEKGFSVSPQQCEDKFNDLNKRY
KRVNDILGKGIACRVVENQGLLESMDHLTVKLKDEVKKLLNSKHLFFREMCAYHNSCGHLGGHDQPPQQNPISIPSQQNC
FHAAEAGKMARIVERVEVEEEVESDMAEDSESEMEESEEEVEEDTRKKQRISTAVKRLREEATRVVEDVGKSVWEKKEWM
KRKMLEIEEKKIGYEWEAVEMEKQRVKWMRYRSKKEREMEKAKLDNQRRRLETERMVLNLRRTEIELSELQSSGKRVDLS
SAKG*

DNA
ATGCCGCAAAATCCACAAAATCCAGTTCAATTCCAGCATCCTCATCCTTACACCACCTCCGGCGACCAACAAACTCAGCC
GCCGATGAAATCCTTATACCCATACGCCTCAAAACCCAAACAATTGTCACCCATAAGCGGTGCCGGCGACGACGAAGATC
GCGGGTCGGGTTCCGGATCCGGTTGCAACCCTGAAGACAGCGCGGGAACCGACGGGAAGAGGAAATTGTCACAATGGCAT
AGAATGAAATGGACGGATACAATGGTTCGTCTTTTGATCATGGCGGTTTTCTACATCGGCGACGAAGCTGGTTTAAACGA
TCCAATTGACCCCAAGAAAAAGACCGGCGGTGGCGGCGGAGGAGGGATGTTGCAGAAGAAAGGGAAGTGGAAATCTGTGT
CGAGAGCTATGGTGGAGAAAGGTTTCTCTGTGTCACCACAACAATGTGAAGACAAGTTCAATGATTTGAACAAAAGGTAC
AAGAGAGTTAACGACATTCTTGGTAAAGGAATCGCTTGTCGTGTCGTAGAGAATCAAGGATTGTTAGAGAGTATGGATCA
TTTGACTGTGAAGTTGAAAGATGAAGTCAAGAAGTTGCTTAATTCTAAGCATCTTTTCTTTAGAGAGATGTGTGCTTATC
ATAATAGTTGTGGTCATCTTGGTGGTCACGACCAACCACCGCAACAGAATCCGATTTCGATTCCTAGTCAGCAGAACTGT
TTTCACGCGGCTGAAGCAGGGAAAATGGCGAGAATTGTGGAGCGTGTGGAGGTGGAGGAGGAAGTAGAGTCTGATATGGC
GGAGGATTCGGAATCGGAGATGGAGGAATCAGAGGAGGAGGTGGAAGAAGATACGAGGAAGAAGCAGAGGATATCAACGG
CGGTGAAGCGGTTGAGGGAAGAAGCGACGCGTGTAGTGGAAGATGTTGGGAAAAGCGTGTGGGAGAAGAAAGAGTGGATG
AAGAGAAAAATGTTGGAGATTGAGGAGAAAAAGATTGGGTATGAGTGGGAAGCAGTGGAGATGGAGAAGCAGAGGGTGAA
GTGGATGAGATATAGGAGCAAGAAGGAGAGAGAGATGGAGAAGGCTAAGCTTGACAATCAGCGACGGAGGCTTGAAACGG
AGAGGATGGTTCTGAATTTACGGCGGACTGAGATTGAGTTGAGTGAGTTACAGTCTTCGGGTAAACGGGTTGACCTTAGT
TCCGCTAAAGGGTGA