Details for Lyrate rockcress Locus 16039625

Position : sca3 ( 5`- 4723279 .. 4722189 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039625

Protein [Map View]
MSKFTGFTSLAISYFLLVSTIVAATDVHYCDNNEEYEVKVQGVDIIPDPVARGAPATFSISANTDTEISSGKLVIEVSYF
GWHIHSETHELCDETSCPVAVGDFVVEHSQVLPGYTPPGSYSLKMKMLDGRKKELTCIKFSFEIGFLSSVADI*

DNA
ATGTCGAAGTTTACGGGATTTACTTCTCTCGCTATCTCTTATTTTCTCTTGGTTTCAACGATTGTCGCAGCCACCGATGT
TCACTACTGCGATAATAATGAAGAGTATGAAGTAAAAGTACAAGGAGTTGATATAATTCCTGATCCTGTAGCTAGAGGCG
CGCCAGCCACTTTCAGCATTTCTGCTAACACAGACACTGAGATCTCGAGCGGCAAGTTGGTGATCGAAGTCTCATACTTT
GGATGGCATATTCATTCTGAGACACATGAGCTTTGTGATGAGACAAGTTGTCCTGTGGCGGTTGGGGATTTCGTGGTAGA
ACACTCGCAAGTTCTGCCCGGATATACTCCTCCTGGTTCGTACTCACTAAAAATGAAGATGCTTGATGGACGCAAGAAGG
AGTTAACTTGCATCAAATTCTCATTTGAGATTGGATTTTTATCATCCGTGGCTGACATTTAG