Details for Lyrate rockcress Locus 16039578

Position : sca3 ( 5`- 11152612 .. 11151622 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342532 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039578

Protein [Map View]
MTFCNKLSSILRQGVSQSSNVPVTSMVGSLRYMSTKLFVGGLSWGTDDSSLKQAFSNFGEVTEGAESIALMELNGRNIRV
NLANERPSAPRSSFGGGGGYGGGGGY*

DNA
ATGACATTCTGCAACAAACTTAGCAGTATTTTGAGACAAGGGGTTTCTCAGAGCTCAAATGTTCCAGTGACATCTATGGT
TGGCTCTCTCCGTTACATGTCCACTAAGCTTTTTGTTGGTGGTCTCTCTTGGGGAACTGATGACAGCTCCTTAAAGCAAG
CTTTCTCTAACTTTGGTGAAGTCACAGAAGGAGCTGAATCCATAGCATTGATGGAGCTGAACGGTAGGAACATCCGCGTG
AACCTTGCAAATGAAAGACCGAGTGCCCCGAGATCATCGTTTGGTGGTGGTGGTGGTTATGGTGGCGGAGGTGGCTACTA
A