Details for Lyrate rockcress Locus 16039537

Position : sca3 ( 5`- 7977897 .. 7977404 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039537

Protein [Map View]
MAERFSSGEAQYWPIYGSSTTTPTVSNSPIASVFHQLRSHSPTSSQLFGFLALFISSGILLFLLGVSVTAAVLGFIVFLP
LIIISSPIWIPVFVLVGGFLTVSGFLVGTVTVLSWTYRYFRGMHPVGSNQMDYARSRIYDTASHVKDYAREYGGYFHGRA
KDAA

DNA
ATGGCGGAAAGGTTCTCTAGCGGCGAGGCCCAATATTGGCCCATCTACGGTAGCTCCACCACCACCCCCACTGTTAGCAA
CAGCCCCATCGCGTCGGTTTTCCATCAGCTCCGATCTCATTCTCCAACCTCCTCGCAGCTCTTTGGTTTCCTCGCTCTCT
TTATCTCCAGTGGAATCCTCCTCTTCCTCCTCGGTGTAAGCGTCACCGCCGCCGTGCTCGGCTTCATTGTGTTTCTTCCA
TTGATCATCATCTCGAGTCCGATATGGATTCCTGTTTTTGTCCTCGTGGGCGGGTTCTTAACGGTCTCTGGATTTCTGGT
CGGAACGGTGACAGTCCTGTCGTGGACGTACCGCTATTTCCGGGGAATGCACCCGGTTGGATCGAATCAGATGGATTATG
CACGTAGTCGGATCTATGACACGGCCTCTCACGTCAAAGATTACGCTAGAGAATACGGTGGTTACTTCCATGGCAGGGCT
AAAGATGCGGCCCC