Details for Lyrate rockcress Locus 16039518

Position : sca3 ( 5`- 3993666 .. 3987529 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_341139 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039518

Protein [Map View]
MEGEVREKDGSVQGRRSETEFIHGLSQEQSIFNYMQHNHQPESDRRRLSLENMSCTQLLALAINTVATSSSIDAPLLKPQ
YDVSTPQKFLCDLNLTPEEMVSTSAQLTEPEFPAITLETPGKTLSETHDRIKKSVLETGSPAGVKKRKRARDDKKVQLAT
PTLKRKKIRPKLKAIVSKMQSTICRKKRSQPDRIASQFNARVLDLQWRRQNPTGTSLAEIWERSLTIDAITKLFEELDIN
KESSCLPHNRETALILYKKAYAEQQAIVKYSKKQKPKVQLDPETSRVWKLLMLSIDSDGVDGSDEEKRKWWEEERNMFHG
RANSFIARMRVVQGNRTFSPWKGSVVDSVVGVFLTQNVADHSSSSAYMDLAAEFPVDWNFNKGSCLEEWGSSVTHETVTN
LDPRIGVSTPRIRYPTCVIIEEIDDDEDDIDVVCSQESSKTSDSSISSANQSKMMLLDPFNTVLMNEQVDSQMVKGKGHM
PYTDDLNGMSEGISMVSSTSTHCELNLNEVPPEVELCSHQRELESTIQPQDQQENTRTEDVKKNRKKPTTSKLKKKSTEP
AKSNKKKSFDWDSLRKQAESGGRKRERTERTMDTVDWDALRCTDVNKIANIIIKRGMNNMLAERIKAFLNRLVRKHGSID
LEWLRDIHPDQAKEYLLSINGLGLKSVECVRLLSLHQIAFPVDTNVGRIAVRLGWVPLQPLPDELQMHLLELYPVLESVQ
KYLWPRLCKLDQKTLYELHYHMITFGKVFCTKVKPNCNACPMKAECRHYASARASARLALPEPEESDRTTVMVHERRYKR
KPFVVNFRPSLFLFQEKEHEAQRSQNCEPIIEEPASPEPEYIERDIEEYPWNNNNVGTSKDPWENKDVIPTIMLNKEAGT
SHLVVNKEAGTSQDLVVLSTYAAAIPRRKLKIKEKLRTEHNVYELPKYHSILEGFERHEDDDLVPYLLAICTPGEEEESH
NTVRGTILIPCRTAMRGGFPLNGTYFQTNEVFADHGSSINPIEVPTQSIWDLRRRIAYFGSSVSSICKGLSVKEIEDNFQ
EGYVCVRGFDRENRKPKSLVKRLHCSHIAIRTKEKTEE*

DNA
ATGGAAGGAGAAGTGAGAGAGAAAGACGGTAGCGTTCAAGGGAGACGATCAGAGACAGAATTTATACATGGTCTGTCACA
AGAGCAATCAATATTTAATTACATGCAACACAACCATCAGCCTGAATCAGACAGGAGGAGGCTTAGTCTCGAAAACATGT
CTTGTACACAGCTCTTGGCTCTGGCTATTAACACGGTCGCCACGAGTTCATCAATTGATGCACCACTGCTAAAACCACAA
TATGATGTGTCAACTCCACAGAAGTTTCTTTGTGACCTTAATCTTACACCTGAAGAGATGGTGAGCACCAGTGCGCAACT
AACGGAACCTGAGTTTCCTGCAATAACTTTAGAGACACCAGGAAAAACATTGTCTGAAACTCACGACCGTATCAAGAAGT
CTGTTCTTGAAACTGGATCTCCTGCAGGAGTAAAGAAAAGAAAGAGAGCAAGAGATGATAAGAAAGTCCAACTGGCAACA
CCAACATTAAAGAGAAAAAAGATCAGGCCAAAGCTTAAAGCCATCGTTTCCAAGATGCAATCAACAATTTGTAGAAAGAA
GCGGAGTCAACCAGATCGTATAGCAAGCCAGTTCAATGCAAGGGTACTAGACCTACAGTGGAGACGCCAAAATCCAACAG
GTACATCGCTAGCTGAAATATGGGAAAGAAGTTTGACTATTGATGCCATCACTAAGTTGTTTGAAGAACTAGACATCAAC
AAAGAGAGTTCTTGTCTTCCACACAATAGAGAAACTGCACTTATTCTATACAAAAAGGCATATGCAGAGCAACAGGCAAT
AGTGAAGTATAGCAAGAAGCAGAAACCGAAAGTACAGTTGGATCCTGAAACGAGTCGAGTGTGGAAACTCCTAATGTTAA
GTATCGACAGTGACGGTGTTGATGGATCAGATGAGGAAAAACGTAAATGGTGGGAAGAGGAGAGGAACATGTTCCATGGA
CGTGCAAACTCGTTCATTGCGCGAATGCGTGTTGTCCAAGGCAATAGAACTTTCTCACCTTGGAAAGGATCGGTTGTAGA
TTCAGTAGTGGGAGTTTTCCTAACCCAGAATGTCGCAGACCATTCATCAAGTTCTGCATATATGGATTTAGCTGCTGAGT
TTCCTGTGGACTGGAACTTCAACAAGGGATCATGTCTTGAAGAGTGGGGAAGTTCAGTAACTCATGAAACAGTAACGAAT
TTGGATCCGAGAATTGGAGTTTCAACTCCAAGAATTCGCTATCCAACTTGCGTCATCATAGAGGAGATTGATGATGATGA
GGACGACATTGATGTTGTTTGTAGTCAGGAATCCTCTAAAACCAGTGACAGTTCCATAAGTTCTGCAAACCAATCAAAAA
TGATGCTGCTGGATCCATTTAACACAGTTTTGATGAACGAGCAAGTTGATTCCCAAATGGTAAAAGGCAAAGGTCATATG
CCATACACGGATGATCTTAACGGAATGTCCGAGGGGATTTCTATGGTCTCATCTACTTCTACTCATTGCGAGTTGAACCT
AAATGAAGTACCACCTGAAGTAGAGTTGTGCAGTCATCAACGAGAATTGGAGAGTACCATTCAGCCACAAGACCAGCAAG
AGAACACAAGAACGGAGGATGTGAAGAAGAATAGGAAAAAACCAACTACTTCCAAACTAAAGAAAAAGTCAACGGAACCA
GCAAAGAGCAACAAAAAGAAAAGCTTTGACTGGGATAGTTTGAGAAAGCAAGCAGAAAGTGGTGGCCGAAAGAGAGAGAG
AACAGAAAGAACAATGGACACAGTTGATTGGGATGCACTTCGGTGTACCGACGTAAACAAGATCGCCAATATTATCATAA
AACGAGGGATGAACAACATGCTTGCCGAAAGAATCAAGGCCTTCTTAAACAGACTGGTTCGAAAACATGGAAGCATAGAC
TTGGAGTGGCTAAGAGATATTCACCCTGACCAAGCCAAGGAGTATCTACTAAGCATAAATGGATTAGGATTGAAAAGTGT
GGAGTGTGTTAGACTTCTGTCACTACATCAGATTGCATTCCCTGTTGACACGAATGTCGGACGCATAGCTGTAAGACTAG
GATGGGTTCCGTTACAGCCATTGCCTGACGAGCTGCAAATGCATCTTTTAGAGCTGTACCCAGTATTAGAATCAGTGCAA
AAGTATCTCTGGCCACGCCTCTGCAAGCTTGACCAAAAAACCTTGTACGAGCTGCATTACCACATGATTACATTTGGAAA
GGTCTTTTGCACAAAAGTAAAACCCAATTGCAATGCTTGTCCTATGAAGGCCGAGTGCCGACATTACGCTAGTGCACGTG
CAAGCGCACGGCTTGCTCTACCAGAACCAGAGGAGAGTGACAGAACAACAGTAATGGTACATGAGAGAAGATATAAACGC
AAGCCTTTTGTGGTTAATTTTCGACCATCCTTATTTCTTTTTCAAGAAAAAGAGCACGAAGCACAAAGATCCCAAAACTG
TGAACCAATCATTGAGGAACCAGCATCACCAGAACCAGAGTATATAGAACGTGATATTGAGGAATATCCTTGGAACAATA
ACAACGTTGGAACATCAAAGGATCCTTGGGAAAATAAGGACGTAATTCCTACAATCATGCTCAACAAGGAAGCTGGTACA
TCACATCTGGTGGTCAATAAGGAAGCTGGTACATCACAGGATTTGGTGGTACTAAGCACATATGCAGCAGCAATACCTAG
ACGTAAACTCAAGATCAAGGAAAAGCTACGCACAGAGCACAACGTCTATGAGCTCCCTAAGTACCATTCCATTCTAGAAG
GGTTTGAGAGGCATGAAGATGATGATTTAGTTCCCTACTTGTTAGCAATTTGCACGCCAGGTGAAGAAGAGGAATCACAT
AATACAGTTCGAGGAACAATATTGATACCTTGCAGAACAGCAATGAGAGGTGGATTCCCTCTAAATGGCACATACTTCCA
AACCAATGAGGTTTTTGCTGACCATGGCTCTAGCATCAACCCAATCGAAGTCCCAACACAATCGATATGGGATCTACGTA
GAAGAATCGCATACTTTGGATCATCTGTATCCTCGATTTGTAAAGGTTTATCAGTGAAAGAAATTGAAGACAATTTCCAG
GAAGGATATGTATGTGTAAGGGGATTTGACCGGGAGAATCGTAAGCCGAAGAGTCTAGTGAAAAGACTGCATTGTTCTCA
CATAGCAATCAGAACTAAAGAGAAGACAGAGGAATGA