Details for Lyrate rockcress Locus 16039512

Position : sca3 ( 5`- 1307473 .. 1310769 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477651 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039512

Protein [Map View]
MSMQPYGIQSMLKEGYRHLSGLDEAVIKNIEACKELSTITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEIQHPAA
KLLVLAAKAQQEEIGDGANLTISFAGELLQNAEELIRMGLHPSEIISGYTKAVNKAVEILEQLVESGSETMDVRNKDEVI
SRMRAAVASKQFGQEEIICSLVADACIQVCPKNPTNFNVDNVRVAKLLGGGLHNSCIVRGMVLKSDAVGSIKRMEKAKVA
VFAGGVDTTATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSIGEMALHFCERYKIMVLKISSKFE
LRRFCRTAGAVAHLKLSRPSPDDLGYVDSISVEEIGGVTVTIARNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNTYK
AMCRDSRIVPGAAATEIELAQRLKEYANAEIGLDKYAISKYAESFEFVPKTLADNAGLNAMEIIAALYTGHGSGNTKLGI
DLEEGACKDVSETKVWDLFATKLFALRYASDAACTVLRVDQIIMAKPAGGPRRDAAQAAGAGAEED*

DNA
ATGTCGATGCAGCCATATGGTATCCAATCGATGCTTAAAGAAGGTTACAGGCATCTCTCTGGTCTCGACGAAGCCGTCAT
TAAGAACATTGAAGCTTGCAAGGAGCTCTCCACCATTACTCGCACCTCTCTCGGTCCCAATGGAATGAATAAAATGGTTA
TCAATCATTTGGACAAACTGTTTGTCACTAATGACGCTGCTACTATTGTGAATGAACTGGAGATTCAGCACCCGGCTGCT
AAACTTCTGGTTTTAGCTGCTAAGGCTCAGCAAGAAGAAATCGGAGATGGAGCTAATCTGACTATCTCTTTTGCTGGTGA
GCTTCTTCAAAACGCTGAGGAGCTTATCAGGATGGGGCTTCATCCCAGTGAGATCATTAGTGGATATACTAAAGCTGTCA
ACAAGGCTGTTGAAATACTGGAACAACTGGTTGAGAGTGGTTCTGAGACCATGGATGTTCGTAACAAGGATGAAGTTATT
TCTCGGATGAGAGCAGCTGTTGCAAGCAAGCAGTTTGGGCAAGAGGAAATAATATGCTCTTTAGTTGCTGACGCATGTAT
TCAAGTGTGCCCAAAGAATCCGACAAACTTCAATGTGGATAATGTCCGTGTTGCCAAGCTTTTGGGAGGAGGCTTGCACA
ATTCTTGCATAGTCCGTGGTATGGTCTTGAAAAGTGATGCTGTTGGTAGCATTAAGCGAATGGAGAAGGCGAAGGTTGCT
GTATTTGCTGGCGGCGTTGATACTACCGCAACCGAGACCAAAGGAACTGTCCTCATTCATAGTGCTGAGCAGCTAGAGAA
CTATGCAAAGACAGAGGAAGCTAAAGTTGAGGAGTTGATTAAAGCTGTTGCAGAATCAGGAGCCAAAGTAATCGTTAGTG
GGGGATCAATTGGAGAAATGGCATTGCATTTCTGTGAGCGCTACAAGATAATGGTATTGAAAATCAGCTCAAAGTTTGAA
CTGAGGCGCTTCTGCCGTACAGCTGGGGCTGTCGCCCATTTGAAGCTTAGCCGCCCAAGCCCTGATGATCTGGGATATGT
TGATTCTATATCAGTTGAGGAAATTGGTGGTGTAACAGTCACGATTGCAAGAAATGAGGAAGGTGGTAACTCCATCTCTA
CCGTGGTTTTGCGTGGAAGCACAGATAGCATTTTGGACGACCTTGAGAGAGCTGTTGATGATGGTGTTAATACATACAAG
GCCATGTGCAGAGACAGCCGTATTGTTCCTGGGGCTGCAGCTACCGAGATAGAATTGGCTCAAAGATTGAAGGAATATGC
CAATGCAGAAATAGGGTTAGACAAATATGCCATCTCCAAATACGCTGAGAGTTTTGAGTTTGTACCCAAAACCCTTGCAG
ATAATGCTGGCCTCAATGCCATGGAAATCATAGCCGCTCTGTACACTGGACATGGATCTGGAAACACAAAACTAGGCATT
GACTTAGAGGAAGGTGCTTGTAAAGATGTTTCAGAGACAAAAGTATGGGATCTTTTTGCAACCAAGTTATTTGCTCTTAG
ATATGCTTCAGATGCTGCATGCACTGTACTTCGTGTAGACCAGATTATAATGGCGAAACCAGCCGGTGGACCAAGGAGAG
ATGCAGCTCAAGCTGCAGGTGCTGGTGCGGAGGAAGACTAA