Details for Lyrate rockcress Locus 16039487

Position : sca3 ( 5`- 3580762 .. 3581819 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039487

Protein [Map View]
MVNTLHAFQTTLTPNFHVLFNASRHPISRTQFLCLSKSGDGTSDSDSDPDPPKPEGDTRRQELLARIAMIQTSKVRLTDF
LDERSEYLTKFAEEANVEFDKVGEDAMKDLDEASTRILENIESKMQAFEESAGLNRLEIEENDSKLAEFEEKIQVDRNEG
LFFKSLRDKKPVDRKQAKQEADKIQEVTKESAGSKSRRNIYLGLIGIVVLAIADSFISSPDWRKVAILGAILVPLLTQFV
YEQTLLSEEANKGK*

DNA
ATGGTGAACACACTTCATGCATTTCAGACAACCTTAACACCAAACTTCCATGTTCTTTTCAATGCCTCGAGACATCCCAT
CTCCAGAACCCAATTTCTCTGTCTCTCCAAATCGGGAGACGGAACTTCAGATTCTGATTCTGATCCCGACCCTCCAAAAC
CCGAAGGCGATACTCGGAGACAAGAACTCTTAGCCAGGATCGCCATGATTCAGACTTCGAAGGTCCGTTTAACGGATTTC
TTGGACGAGCGATCAGAGTATCTCACCAAGTTTGCTGAAGAAGCCAATGTGGAGTTTGACAAGGTTGGAGAAGACGCCAT
GAAAGACCTTGACGAAGCTAGCACAAGGATACTGGAGAATATCGAAAGCAAGATGCAAGCTTTTGAGGAATCTGCGGGAT
TGAACAGATTAGAGATAGAGGAGAACGATAGTAAGTTGGCTGAGTTTGAGGAGAAGATCCAAGTAGACAGGAATGAAGGA
TTGTTCTTTAAAAGCTTACGTGACAAAAAACCGGTGGATAGAAAGCAAGCTAAACAGGAAGCTGATAAAATACAAGAAGT
TACCAAAGAAAGTGCAGGATCAAAGTCAAGAAGGAATATTTACCTCGGGTTAATTGGGATCGTGGTTCTCGCAATTGCTG
ATTCCTTCATTTCTTCACCGGATTGGAGAAAAGTAGCAATTCTTGGAGCTATTCTTGTCCCACTGCTCACTCAATTCGTC
TACGAGCAGACATTATTATCAGAAGAAGCAAATAAGGGAAAGTGA