Details for Lyrate rockcress Locus 16039470

Position : sca3 ( 5`- 7568173 .. 7568006 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039470

Protein [Map View]
MTLPTTNLPKLVNKYCGISYFIFDKTLIMCCGEGETGAACIYMVRGGMYVQEDSD*

DNA
ATGACATTGCCAACAACCAACTTGCCTAAGCTCGTTAATAAGTATTGTGGTATTAGTTATTTCATCTTTGACAAGACCCT
AATCATGTGTTGTGGCGAAGGCGAAACTGGAGCTGCTTGCATCTATATGGTAAGGGGAGGTATGTATGTTCAAGAAGATT
CAGATTGA