Details for Lyrate rockcress Locus 16039463

Position : sca3 ( 5`- 4438945 .. 4442190 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039463

Protein [Map View]
MPKSNDADVAESEAVPLLDLAKPSLPISFPIKSLQDLKSRSYFVSFHFQFNRSTVPLRRDSDDLPNRPRVLVCHDMKGGY
VDDKWVQGCENDAGFAIWHWYLMDIFVYFSHSLVTLPPPCWTNTAHRHGVKVLGTFITEWDEGKATCKEMLATKESAQMY
AERLAELATALGFDGWLINIENDIDEEQIPNLKEFVSHLKKVLQKKSCIYLHLGRWYDSVTIHGNLQWQDQLTELNKPFF
DLCDGIFMNYTWKESYPKLSAEVAGDRKFDIYMGIDVFGRGSFGGGQWTVNAALDLLKRSNVSAAMFAPGWVYETAQPPN
FHTAQNKWWSIVEKSWGIVQTYPQVLPFYSDFNQGFGYHVSLEGRQLSDAPWYNISYQSLQPLLEFNEEDNKDIIHVTVD
KKGKMFLTILSKHLNNYYEFDSAREASFNGGGNIAFRGKLKGDAYFTTRLFKPHLQLSSSPITISYSVKSDETSKLGILL
SFSSPSQETKSILVAPQDSIRRFNGMFSQCLATSAQTVSEWTVHETSLVMDGHTLTEISAFCYRPDNSTKSAEYVALLGH
ISIKDHVQSQHKPETLLPASPWVIEAHNIELVQGNSGSKSLRVKLEWRQKDLEDSAFPKYNVYAENVKSTDLRSRKVLEK
PISETVFLGVAHVPAYYVGELVVESDVKGVRFVVQACGKDGSWANLDDSPKLLVELEGLSFQDSS*

DNA
ATGCCCAAATCCAATGATGCCGATGTCGCAGAATCTGAAGCCGTTCCGTTGCTCGATCTTGCCAAGCCGTCGTTACCTAT
ATCTTTCCCGATCAAATCTCTTCAAGATCTGAAATCTCGTTCTTACTTCGTTTCCTTTCACTTCCAGTTTAATCGCTCCA
CCGTACCTCTCCGGCGAGACTCCGATGACTTACCGAATCGCCCAAGGGTTTTAGTCTGCCATGACATGAAAGGAGGGTAT
GTAGATGACAAGTGGGTACAAGGATGTGAAAACGACGCCGGATTTGCGATTTGGCATTGGTATTTGATGGACATTTTTGT
TTACTTCTCTCATTCTTTGGTCACTCTTCCTCCTCCTTGCTGGACTAATACTGCTCATAGGCATGGCGTTAAAGTATTGG
GGACTTTCATCACAGAATGGGATGAAGGTAAAGCTACCTGCAAAGAGATGCTTGCCACAAAAGAGTCTGCTCAGATGTAT
GCAGAGCGTTTGGCAGAACTTGCTACTGCTCTTGGCTTTGATGGGTGGCTGATTAATATAGAGAATGATATAGATGAGGA
GCAGATTCCAAATTTGAAGGAATTTGTAAGCCATCTAAAAAAAGTCTTGCAAAAAAAGTCTTGCATTTATCTACACCTGG
GGCGTTGGTATGACAGTGTCACTATTCATGGTAATCTTCAATGGCAAGATCAATTGACTGAGCTGAACAAACCTTTCTTT
GACTTATGCGATGGAATATTCATGAACTATACATGGAAGGAGAGCTACCCAAAACTATCAGCTGAAGTTGCCGGGGACAG
AAAGTTCGACATCTACATGGGAATTGATGTCTTTGGCCGGGGCTCTTTTGGTGGTGGGCAATGGACTGTAAATGCTGCTC
TTGATTTGCTGAAGAGAAGCAATGTGTCAGCTGCCATGTTTGCTCCTGGATGGGTTTATGAGACTGCACAACCCCCCAAT
TTTCATACAGCTCAGAATAAATGGTGGTCAATTGTCGAGAAGTCATGGGGAATAGTCCAAACTTATCCACAAGTCTTGCC
TTTTTACTCGGATTTCAATCAGGGCTTTGGTTACCATGTTTCACTCGAAGGTCGCCAACTGTCAGATGCTCCATGGTACA
ACATATCTTACCAAAGTCTTCAGCCTCTCTTAGAATTCAATGAAGAAGACAACAAAGATATCATCCACGTCACTGTTGAC
AAAAAGGGAAAAATGTTTTTGACAATTCTGAGCAAACATTTAAACAATTACTATGAATTTGATAGTGCTCGAGAGGCATC
TTTTAACGGAGGAGGGAACATCGCTTTTAGAGGAAAACTCAAGGGAGATGCGTATTTCACAACAAGGCTCTTCAAACCCC
ATCTTCAGCTTTCATCTTCCCCCATCACAATCTCCTACTCTGTGAAATCAGATGAAACCTCTAAACTTGGAATCCTGCTT
TCTTTCTCATCTCCGTCACAGGAGACGAAATCCATTCTCGTTGCTCCACAAGATTCCATCCGTAGATTCAACGGCATGTT
CTCACAGTGTCTCGCCACATCAGCGCAGACTGTATCCGAGTGGACGGTACACGAGACAAGCCTTGTCATGGATGGTCACA
CACTGACTGAAATCTCTGCCTTTTGCTACAGACCAGATAATTCGACAAAGAGTGCAGAATATGTTGCATTGCTGGGACAC
ATCTCAATCAAAGATCATGTTCAGTCCCAGCATAAACCCGAGACTTTACTTCCAGCATCACCGTGGGTCATCGAAGCTCA
TAACATAGAGCTTGTACAGGGTAATTCTGGTTCTAAGAGCCTCAGGGTTAAGCTAGAATGGAGACAGAAAGACCTTGAAG
ATTCTGCATTCCCAAAGTACAATGTGTATGCAGAGAATGTGAAGTCGACTGATCTAAGATCGAGGAAGGTGCTAGAGAAA
CCGATAAGTGAGACAGTGTTCCTTGGAGTCGCTCACGTACCAGCCTATTACGTAGGGGAACTGGTGGTAGAATCAGACGT
GAAAGGAGTCCGCTTCGTAGTTCAAGCCTGTGGCAAAGATGGTTCATGGGCCAATTTGGATGATTCCCCTAAGCTTCTAG
TTGAACTGGAAGGTCTCTCGTTTCAAGATTCGTCGTAG