Details for Lyrate rockcress Locus 16039460

Position : sca3 ( 5`- 1069024 .. 1067553 -3` )
Annotation : [B2G] chat-3-hexen-1-ol acetyltransferase
External links : CoGe
PGDD synteny : 16039460

Protein [Map View]
MDHQVSLPQSTTTGLSFKVHRQQPELITPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYRPNLSSDLNPVQVIKKALADA
LVYYYPFAGRLRELSNRKLAVDCTGEGVLFIEAEADVSLTELEEADALLPPFPCLDELLFDVEGSSDVLNTPLLLVQVTR
LKCRGFIFALRFNHTMTDGAGLSLFLKSLCELAYRLHAPSVPPVWDRHLLTVSASEARVTHTHREYEDQVAIDAVDTGDP
FVSRSFFFSAEEISAIRKLLPPDLHNTSFEALSSFLWRCRTIALNPDPNTEMRLTCIINSRSKLSNPPLSRGYYGNVFVI
PAAIATARDLMEKPLEFALRLIQETKSSVTEDYVRSVTALMATRGRPMFVAAGNYIISDLRHFDLGKVDFGPWGKPVYGG
TAKAGIALFPGVSFYVPFKNKKGETGTVVAISLPVRAMERFVAELNGVLIKRF*

DNA
ATGGACCATCAAGTGTCTCTGCCACAATCTACCACCACTGGTCTCTCTTTCAAGGTGCATCGCCAGCAGCCGGAGCTAAT
CACTCCGGCTAAACCAACACCACGAGAGCTCAAGCCTCTCTCCGACATAGATGACCAACAAGGACTAAGATTTCAAATTC
CAGTTATATTTTTCTATAGACCTAACCTTTCAAGTGATCTCAATCCGGTCCAAGTGATAAAGAAAGCCCTCGCAGATGCG
CTGGTTTACTACTATCCGTTCGCTGGTAGGCTCCGGGAACTTTCAAACCGGAAACTCGCAGTGGACTGCACCGGTGAAGG
CGTTTTGTTCATCGAGGCTGAAGCTGACGTGTCCCTTACTGAGCTGGAGGAGGCTGATGCTCTTCTCCCTCCGTTCCCTT
GCCTAGATGAGCTTCTCTTTGATGTGGAAGGCTCTAGTGATGTGCTTAACACTCCTCTGCTTCTCGTCCAGGTCACGCGA
TTGAAGTGCCGCGGATTTATCTTTGCCCTCCGTTTCAACCATACCATGACCGATGGAGCAGGCCTGTCGCTCTTTCTGAA
ATCACTATGCGAGTTGGCGTATAGGCTTCACGCGCCCTCGGTTCCACCCGTATGGGACCGACACTTGTTGACTGTGAGTG
CTTCGGAGGCGCGTGTGACACACACACACCGTGAGTATGAAGATCAGGTGGCAATCGATGCGGTCGACACTGGAGACCCT
TTCGTTAGCCGGTCTTTCTTTTTCAGCGCGGAAGAGATCTCCGCCATACGGAAACTTCTTCCGCCCGATCTCCACAATAC
CTCATTTGAAGCTTTGTCGTCATTTTTGTGGCGTTGTCGAACAATTGCGTTGAATCCTGACCCCAACACTGAGATGCGAC
TAACTTGCATCATCAACTCGCGTTCCAAGCTTAGCAACCCACCACTATCGCGGGGTTACTACGGAAATGTGTTCGTCATT
CCCGCGGCAATAGCAACAGCAAGAGATCTTATGGAGAAACCTCTTGAGTTTGCTTTGAGGTTGATACAAGAAACGAAGTC
AAGTGTGACTGAGGACTACGTCCGCTCAGTGACTGCCCTAATGGCCACTAGAGGCCGGCCTATGTTTGTGGCAGCGGGGA
ATTACATCATATCGGATTTAAGACACTTTGATTTAGGAAAAGTTGATTTTGGACCGTGGGGTAAGCCAGTGTACGGTGGA
ACCGCTAAGGCCGGTATCGCGCTTTTTCCTGGAGTGAGCTTCTACGTGCCGTTTAAGAATAAAAAAGGTGAGACGGGTAC
CGTTGTGGCGATTAGCTTGCCGGTGCGGGCAATGGAGAGGTTCGTAGCAGAGCTAAATGGAGTGCTAATTAAACGTTTTT
AA