Details for Lyrate rockcress Locus 16039448

Position : sca3 ( 5`- 3120533 .. 3118537 -3` )
Annotation : [B2G] carboxyl terminus of hsc70-interacting protein
External links : CoGe
PGDD synteny : 16039448

Protein [Map View]
MVTGVASPMAERLKEEGNNCFKKERFGAAIDAYTEAIALSPNVPAYWTNRALCHMKRKDWTKVEEDCRKAIQLVHNSVKA
HYMLGLALLQKKEYTDGVKELQRALDLGRSSNPTGYMVEEIWEELSKAKYMEWELVSARRSWELSSLKETCEAALNQQCA
LDMSRTEESSDEAYIAHTERLKALERVFEKAAEEDKPTEVPGYLCCNITLEIFRDPVISPSGVTYERAAILEHLKKVGKF
DPITREKIDPSKLVPNLAIKEAVAAYLEKHVWAYKLGC*

DNA
ATGGTTACAGGCGTGGCTTCCCCCATGGCGGAGCGGTTAAAGGAAGAAGGAAACAATTGCTTTAAGAAAGAACGTTTTGG
TGCTGCCATTGATGCTTATACCGAGGCAATAGCCTTGTCTCCAAATGTTCCTGCTTATTGGACAAATCGAGCACTTTGCC
ACATGAAACGAAAGGATTGGACTAAGGTTGAAGAGGATTGTCGCAAAGCTATTCAGCTTGTCCACAATTCCGTCAAGGCC
CACTACATGCTAGGACTTGCATTATTGCAGAAGAAAGAATATACTGATGGAGTCAAAGAGTTGCAAAGGGCTTTAGATCT
TGGAAGAAGCTCGAATCCAACAGGATATATGGTTGAAGAAATATGGGAAGAGCTTTCTAAAGCAAAATACATGGAGTGGG
AACTGGTTTCTGCAAGGCGCTCATGGGAACTGAGTAGTTTGAAGGAAACTTGTGAGGCTGCTCTTAATCAACAATGTGCT
TTAGATATGTCTCGAACAGAAGAGTCCTCAGACGAAGCCTATATTGCCCATACCGAGCGTTTAAAAGCTCTTGAACGAGT
CTTTGAGAAAGCTGCAGAAGAAGATAAACCAACTGAGGTGCCAGGTTATTTGTGTTGCAATATAACTCTTGAGATTTTCC
GAGATCCTGTAATATCTCCAAGTGGGGTTACATATGAAAGAGCAGCAATCCTTGAACATCTCAAGAAGGTGGGGAAATTT
GATCCGATAACGCGTGAAAAAATCGACCCGTCCAAGCTCGTTCCAAATCTGGCTATCAAAGAGGCAGTGGCTGCATATCT
AGAAAAACACGTTTGGGCTTACAAGCTGGGTTGTTGA