Details for Lyrate rockcress Locus 16039438

Position : sca3 ( 5`- 5866296 .. 5864959 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039438

Protein [Map View]
MEDDEDIRSQGSDSPDPSSSPPAGRITVTVASAGPPSYPLTPPATSSQKDPDALALALLPIHASGGGNSSSGRPTGGGGR
EDCWSEGATAVLIDAWGERYLELSRGNLKQKHWKEVAEIVSSREDYGKIPKTDIQCKNRIDTVKKKYKQEKVRIATGGGR
SRWVFFDKLDRLIGSTAKIPTATPGISSGGGPVGGLHKIPMGIPMGNRSNLYHQQAKAATPPFNNIDRLIGATARVSAAS
FGGSGGGGGGGSVNVPMGIPMSSRSTPFGQQGRTLPQQGRTLPQQQQQGMMVKKCSESKRWRFRKRNASDSDSESEAAMS
DDSGDSLPPPPLSKRLKTEEKKKQDGDGVGNKWRELTRAIMRFGEAYEQTENAKLQQVVEMEKERMKFLKELEMQRMQFF
VKTQLEISQLKQQHGRRMGNTSNDHHSRKNNINVIVNNNNDLGNN*

DNA
ATGGAGGACGACGAAGACATCCGATCTCAGGGCTCCGATTCACCTGATCCGTCTTCTTCGCCGCCGGCGGGACGAATCAC
GGTTACGGTGGCTTCGGCAGGTCCGCCTTCTTATCCTCTGACTCCTCCGGCTACTTCGTCGCAGAAGGATCCCGATGCGT
TGGCTCTGGCGCTGCTTCCGATTCACGCCAGCGGTGGAGGGAATAGCAGCAGTGGGAGACCAACCGGTGGCGGCGGGAGG
GAGGATTGTTGGAGCGAAGGGGCTACGGCTGTGTTGATTGATGCGTGGGGTGAGAGATACTTGGAGCTTAGCAGAGGGAA
TCTGAAGCAGAAGCACTGGAAAGAGGTGGCTGAGATCGTGAGCAGCAGAGAGGATTATGGTAAAATCCCCAAAACTGATA
TACAGTGTAAGAATAGGATCGATACGGTGAAAAAGAAGTATAAACAGGAGAAGGTGAGAATCGCTACCGGTGGTGGCCGT
AGCAGATGGGTGTTCTTCGACAAACTTGACCGTCTGATTGGATCAACGGCCAAGATCCCGACGGCAACTCCTGGAATCAG
CAGTGGTGGAGGTCCTGTAGGAGGATTGCATAAGATTCCTATGGGTATTCCCATGGGAAATCGTTCGAATCTGTACCACC
AGCAAGCTAAGGCTGCAACACCGCCTTTCAATAATATTGACCGTCTAATTGGAGCTACGGCTAGGGTCTCAGCTGCTTCG
TTCGGTGGCAGTGGTGGAGGAGGCGGAGGAGGATCTGTCAATGTACCTATGGGAATTCCGATGAGTAGCCGTTCAACTCC
GTTTGGACAGCAAGGTAGGACGCTGCCACAGCAAGGTAGGACGCTGCCACAGCAACAGCAGCAAGGGATGATGGTGAAAA
AGTGTAGTGAGTCGAAACGCTGGCGTTTCAGGAAGAGGAACGCCTCTGATTCAGACTCGGAATCTGAAGCAGCAATGTCA
GATGATTCCGGTGACAGTTTACCTCCTCCTCCTCTGTCGAAGAGGTTGAAGACAGAGGAGAAGAAGAAGCAAGATGGTGA
TGGAGTGGGAAATAAATGGAGGGAGTTAACTCGGGCAATCATGAGATTTGGTGAAGCTTATGAGCAAACAGAGAATGCGA
AACTGCAACAGGTGGTTGAGATGGAGAAAGAGAGGATGAAGTTCTTGAAGGAGCTGGAGATGCAGAGAATGCAGTTCTTT
GTTAAGACCCAATTGGAGATATCACAGCTTAAGCAGCAACATGGGAGGAGAATGGGAAACACCAGTAATGATCATCACAG
CCGCAAGAACAACATCAATGTGATTGTCAACAACAACAACGATTTGGGTAATAACTAG