Details for Lyrate rockcress Locus 16039431

Position : sca3 ( 5`- 6405889 .. 6403552 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039431

Protein [Map View]
MGSEIILCDGFEVVPPPINDLILFGRGQSVSSCDVSTITTEEDGTVFSGDSSPGGAAEEDWPEDKSLSFYFVKQPAYDDP
EIQAKIDEAGHEIKHCNQLRIGVSSAQKSEKAEISSLFSHMVSLTPKSEGYRVVFEEKKREFDTLQEALRNLRCSTSDQL
CFPKEELDHLMYIAHYQIEHGSIGLEEEDWVLKETEKPDGIVLSEDSLVEKEASINRVKSKAVELYQVKKEHDAITWKIN
LLAEKMGKSRNKIKILDVELAHILEKRDRSYERIRMLRIQRDKGKDAFFESLPVMRKAKELAASGNVRDLEVFANSEVER
FMTHWNDDKAFRDDYVKRISLSLCERQLNQDGRIKDPEVQVVGEKQVPVKTMKGGEKVHKTNREDSSSNSSQDGSVIIDK
PTQETRKKAMDFNRSSAEESDVIDLEFSVYEKPKKEEEEVDEETLKESKREEQLEKARLAMERKKKLQEKAAAKAAIRAQ
KEAEKKLKECEKKAKKKAANSSSPSESDQSQEVINELEKGRTLAVSVKEKHQKERSLFPKQRSFRYKHRGRGTEALPKAI
LNRRRAQKYWVWGLSSAALAVALFLVVLLLR*

DNA
ATGGGTTCGGAGATTATACTCTGTGATGGCTTCGAGGTGGTTCCTCCGCCGATAAACGATTTGATACTCTTCGGAAGAGG
CCAATCTGTATCAAGTTGCGATGTATCAACGATCACTACCGAAGAAGACGGCACTGTTTTTTCCGGTGATAGTTCGCCGG
GAGGTGCAGCTGAAGAGGATTGGCCTGAAGATAAATCTTTATCGTTTTACTTTGTTAAGCAACCAGCTTACGATGATCCC
GAGATCCAAGCCAAGATCGATGAAGCTGGTCATGAGATTAAGCACTGTAATCAACTCCGTATTGGTGTCTCCAGTGCTCA
GAAATCCGAAAAGGCTGAGATTTCGTCTTTGTTTTCACATATGGTGAGTTTGACTCCTAAATCAGAAGGATATAGAGTGG
TTTTTGAAGAGAAGAAGAGGGAATTTGATACTCTACAAGAAGCTCTACGGAATCTCCGGTGCTCTACTAGTGATCAACTT
TGTTTTCCAAAGGAGGAACTCGATCATCTTATGTATATAGCTCATTATCAGATTGAACATGGTAGCATTGGTTTGGAGGA
AGAAGATTGGGTGCTTAAAGAGACCGAGAAGCCTGATGGGATAGTTCTAAGTGAGGATTCTCTTGTGGAGAAAGAAGCTT
CCATAAACCGTGTCAAGTCTAAGGCCGTGGAATTGTATCAAGTAAAGAAGGAGCACGATGCGATTACATGGAAGATAAAC
CTCTTGGCTGAAAAAATGGGGAAGAGTCGGAACAAGATCAAGATTTTGGATGTAGAACTGGCACACATACTTGAGAAGAG
GGACAGATCCTATGAAAGGATTAGGATGTTGAGGATACAACGAGACAAAGGGAAAGATGCCTTTTTCGAGAGCCTTCCTG
TTATGAGGAAAGCTAAAGAATTGGCTGCTTCTGGAAATGTTCGAGATCTTGAAGTGTTTGCCAACTCTGAGGTTGAAAGA
TTCATGACTCATTGGAATGATGACAAGGCTTTTAGGGATGATTACGTAAAAAGAATCTCGCTTTCACTCTGTGAAAGACA
GCTGAACCAAGATGGCCGGATTAAAGATCCTGAAGTTCAGGTTGTTGGGGAAAAGCAAGTACCGGTTAAGACTATGAAGG
GAGGCGAGAAGGTTCACAAGACGAATAGAGAAGATTCCAGCTCCAACTCGTCTCAAGATGGAAGTGTAATTATAGATAAA
CCAACACAAGAGACGAGGAAAAAGGCGATGGATTTCAACAGGTCAAGTGCTGAGGAGAGTGATGTTATAGATTTGGAATT
CTCGGTGTATGAGAAACCAAAGAAGGAAGAAGAAGAGGTCGATGAAGAAACTTTGAAGGAAAGTAAAAGAGAAGAGCAGT
TAGAGAAAGCTCGGTTAGCGATGGAGAGGAAGAAGAAGCTGCAAGAGAAAGCTGCTGCTAAAGCTGCTATAAGAGCTCAA
AAGGAAGCTGAAAAGAAACTCAAGGAGTGTGAGAAAAAGGCGAAGAAGAAAGCTGCAAATTCTTCTTCTCCTTCAGAATC
AGACCAATCACAAGAAGTTATCAATGAGCTGGAAAAGGGTAGGACTTTAGCTGTTTCAGTGAAAGAGAAACACCAAAAGG
AGAGATCATTGTTTCCAAAGCAGAGAAGTTTCAGGTACAAACACCGCGGAAGAGGAACCGAAGCTCTCCCTAAGGCAATC
CTAAACCGTAGAAGGGCTCAAAAATATTGGGTTTGGGGACTTTCATCTGCTGCACTTGCTGTCGCACTCTTCCTTGTGGT
TTTACTTCTACGGTAA