Details for Lyrate rockcress Locus 16039428

Position : sca3 ( 5`- 1230525 .. 1232642 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039428

Protein [Map View]
MSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPRGLFSFSALGAQGERFEFSLELYGKIMPEYRKNVGLRNIIFSIQKE
EKSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVKSETASDDESAFVNEDSESSDDDGLLYLPDLEKARSK*

DNA
ATGAGTCGTAATCCGGAGGTTCTTTGGGCTCAGCGTTCTGACAAGGTTTACCTAACCGTCGCCTTACCTGATGCGAAAGA
CATTTCGGTCAAGTGTGAGCCTCGGGGTCTTTTCAGTTTCTCTGCTCTTGGTGCCCAAGGCGAGCGCTTTGAATTCAGCT
TGGAGTTATATGGGAAGATTATGCCAGAATATCGGAAGAATGTAGGGCTAAGGAACATCATATTTTCAATTCAGAAAGAA
GAGAAAAGCTGGTGGACACGACTGCTGAAATCGGAAGAGAAACCCGCACCTTACATCAAAGTCGACTGGAATAAATGGTG
TGATGAGGATGAGGAGGTCAAATCTGAAACGGCCTCTGATGATGAGAGTGCATTCGTTAATGAAGATAGTGAAAGCAGCG
ATGACGATGGATTGCTCTATCTTCCTGATCTGGAAAAGGCGAGAAGCAAGTAG