Details for Lyrate rockcress Locus 16039423

Position : sca3 ( 5`- 5011262 .. 5010011 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897460 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039423

Protein [Map View]
MAGQTDPHTSLFSPQEVEFMAEDELVEIVPNMNMEQLNFISGDFGRFIPQIPTKVPLWLAVALKRRGKCTFRPPGWMSVD
NLTQILEAERESQSTFQALPFSYVEIARLLFDHARDDIPDMYMVRSLVEDIRDVRLHKLETNLGSFQGTSAVKISNVSAM
EVNIVRPFVIRALEAFYKHDKPEADVDRDTRSSRQQREANNEPRRPLRQR*

DNA
ATGGCTGGCCAGACTGATCCTCATACTTCACTATTTTCTCCACAAGAGGTTGAGTTTATGGCAGAGGACGAACTGGTGGA
GATTGTTCCTAATATGAATATGGAGCAACTCAATTTCATCAGTGGCGATTTCGGTCGGTTCATTCCTCAGATTCCGACAA
AGGTGCCTCTGTGGCTTGCAGTGGCACTGAAGAGGAGAGGAAAATGCACTTTCCGGCCTCCTGGGTGGATGTCTGTTGAT
AATTTGACTCAGATCTTGGAAGCAGAACGTGAATCTCAGTCGACATTTCAGGCATTACCATTTAGTTACGTGGAAATTGC
CAGACTACTTTTTGACCATGCACGTGATGATATTCCAGACATGTATATGGTGAGATCCCTAGTCGAGGACATCAGAGATG
TGCGGCTTCATAAACTCGAGACTAACTTGGGATCATTTCAAGGTACATCTGCAGTAAAGATCTCTAATGTATCGGCAATG
GAAGTGAACATAGTCCGCCCATTTGTGATAAGAGCCTTAGAAGCATTTTACAAGCATGACAAGCCAGAGGCTGATGTAGA
CAGAGACACCAGAAGTAGTAGACAACAGCGTGAAGCCAACAATGAACCAAGGAGGCCCTTAAGGCAACGCTAG