Details for Lyrate rockcress Locus 16039378

Position : sca1 ( 5`- 7744539 .. 7748171 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039378

Protein [Map View]
MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGIEAMDVDADSTKTNSNSEDSKTESEKEKGKRKLYVGSQ
AMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKVPALFMAK
NPVLTSFATGRATSLVVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKGIKIRPRYSFKRKEIRAGEF
QVEDVDIPNTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQMLEIGADRFKVPDVMFNPSIVQT
IPGMEKYADMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTE
RRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKCP*

DNA
ATGTACGGCGGAGATGAAGTGTCAGCTATTGTGGTTGACTTGGGTTCGCACACTTGCAAGGCTGGTTACGCCGGAGAAGA
TGCTCCCAAGGCCGTTTTCCCTTCCGTTATTGGGGCAGTAGATGGTATAGAGGCTATGGATGTGGATGCTGATTCTACAA
AGACTAATTCGAATTCTGAGGATTCGAAGACTGAGTCTGAAAAAGAAAAGGGAAAACGCAAGCTCTATGTAGGATCTCAG
GCCATGAGTTACCGCCGAGATCATATGGAGGTTTTGTCACCTATAAAAGACGGCATAGTTTCTGACTGGGATTTGGTCGA
CAATATATGGGAACATGCTTTCAAGAGTTGTCTGATGATTGATCCTACGGAGCACCCAATGCTGCTAGCTGAGCCTCCTT
TGAACACTCAACAGCAGAGAGAGAAGGCGGCAGAGCTAATGTTTGAAAAATACAAAGTTCCTGCATTGTTTATGGCTAAG
AATCCTGTTCTCACGTCTTTTGCTACTGGGCGCGCTACTTCTTTGGTTGTTGACTGTGGTGGAGGATCCACAACTATTTC
ACCTGTGCATGATGGTTATGTTCTTCAAAAGGCTGTTGTATCATCTCCACTTGGAGGGGAATTTCTCACTGACTGCCTAC
TGAAAAGCTTGGAGAGTAAAGGAATTAAAATAAGACCTAGATACTCTTTCAAGAGAAAGGAAATACGAGCAGGGGAATTC
CAGGTTGAAGATGTGGATATTCCTAACACCACGGAAAGCTACAAACTCTTCTGCCAGAGGATGATAGTGGGTGATATCAA
GGATTCTATTTGTCGAGTTCCTGATACTCCCTATGATGATAAATCATATTCAAACATCCCAACTACGTCGTACGAGCTTC
CTGATGGCCAGATGCTCGAGATTGGTGCTGATAGGTTCAAAGTTCCTGATGTGATGTTCAACCCGTCCATAGTCCAGACG
ATTCCTGGAATGGAGAAGTATGCTGATATGATTCCTTCTGTTCGTGGGTTACCACACATGGTCATGGAGAGCATCAACAA
ATGTGATGTAGACATCCGGAGAGAGTTGTATAGTAGCATACTGCTTGCTGGTGGAACATCGTCAATGCAACAGTTGAAAG
AACGTCTCGAAAAGGACTTGATCGAAGAGTCTCCTCACTCGGCTAGAGTTAAAGTGTTGGCAAGCGGTAACACAACAGAA
AGAAGATTCAGTGTATGGATAGGAGGGAGTATATTGGCATCACTAGGCTCATTTCAACAGATGTGGTTCTCCAAGTCTGA
GTATGAGGAACATGGAGCTTCCTACATTCAGAGAAAATGCCCTTAA