Details for Lyrate rockcress Locus 16039331

Position : sca5 ( 5`- 17935194 .. 17930642 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039331

Protein [Map View]
MRSRTVPGLSSQSRIVRCPKCHKLLQEPLDATSYKCGGCDSILHAKRLELEGNDHTNTIPQALLSSQNRSLSAEVESPEY
GSRTPMRSTHREYNSRASPSVERGYHPETVYKHETSDIRREWMRRTDDFSETGDSDAFASARSSPYNTRSNASQWARHEG
RYEDPPQVTFYPASPSPSSAYEYGYSSPFHGSHVSASEQSYYHHHPNQFKQYGREGWFQESSVASPTRFPGETSDGKNYH
RSSQSQLHDLQYHNIYEPSSSVIPHHSVYSERNYVAAAAPHHSTYSEHSIGISKSDTSSENISLRNKKRYVRERNPVVKR
HILPSAGGAPFATCSYCLELLHLPQVSPQGKRKRYQVRCGSCSGVLKFSIREKADTVLDSPSFVDYGMDFADENVTNHQD
SASEGYEEIYPDGNHLPCLDDDFGDTICKSNDAVILSQSLETFEDKGIKEDMRNISGKLLDLKLEALQPHLKPVVNPRLR
EQQPASSETIGETSRIHLEQSQEAHSEKSTEMDNNNCERAWCDLEELEYEKNEIIKPEEIVGEGSGESFEVPVYQNERMS
ESSEEDERVAERSVSHSVEILYENEYVSETRVQSENTGDANESEWEETQENEEYGGESTLKENGDKPQLHLEKYRYIRDS
ICDSSLSYGEPFEDTSVKEDTEHISNTISDDNSLVNENQRFIGHPDQSGEATVTISSIQEQSKYEYENLSERQELEMTIS
DRVRYELEESRYETNETLEPSKVVEDGSVVSFAKASEAFETIIEGETGGERLVSHQMDSPNEKVENSYGTLEPVYLEESG
FAGENTWEGTIYDRAALHLEEYESNYENYSRPFEWTSETAPTFGMHDYELGTILEPDEDADGRSESSSRGSFNDDGSSEE
RVIFHDSQDAIPEQSHDEHESSSKRQELSDTVFDIVRSELQEYRYETNEPLEPSKMVGDESVVPVEKAGETFISEKDEEN
SVSHQMESQNEDMENSYGTIEPVYLEGSRCERENPWAETMGDGVGLKLEEYKSYPFEWTSERAPAFHLHEYEQWTVPEPE
EDANGRSIPSSRDSFNDHESLKEKVVSHEEEPWLLDENKTEALKVGVMVEDGPSLHLTKCENESMKLEETLEWTSERAPT
FRLHEYELGEMLESDNDVDERSDYSSRGSFNDHGNSKERELFNEEEPQLVIDGRTEALQVGQMAKDTVSLHLEECGDESM
KLDETFEWTSGRTLTFRRHGYEVGTKLEPDEDADGRSESSSRGSFNERGSPKERAVLHEVGPWLVDDYENNALKVGVMAE
DGSLHLEKCENGKMELDETLEPSDDIFRLSLDDTLEQERMTFHLKMSQDKQENLRHTFKQGEAEKDVPGFGSRVSSEGHE
SPSKMAELDSDTEEEILGDHLEHLQKQNEKSGLTFEPHAHIYSTTEPSEIVGLRHALYQTQNSPLRSPLTSPIHTPISSP
LHYLMASQIRSPIASPMHSHIVSPLRSPINSSGSLSDVLLFSKKT*

DNA
ATGAGGAGTAGAACCGTGCCTGGATTATCTTCTCAGTCTAGGATCGTGAGATGTCCCAAGTGCCACAAACTTCTCCAGGA
ACCTTTAGATGCGACTTCTTACAAATGTGGTGGATGCGACTCTATTCTTCATGCAAAACGTTTGGAACTGGAAGGCAATG
ATCACACAAACACTATTCCTCAGGCTCTCCTTTCTTCTCAAAACCGCAGTTTAAGTGCTGAGGTAGAATCTCCAGAATAT
GGTAGTAGAACTCCAATGAGAAGTACTCACCGGGAATACAATTCAAGGGCATCGCCTTCTGTTGAAAGGGGTTATCATCC
AGAAACTGTTTACAAGCATGAGACATCCGATATCCGCAGAGAATGGATGAGAAGGACTGATGACTTCAGTGAGACCGGTG
ATTCTGATGCGTTTGCTTCAGCAAGAAGCTCTCCATATAACACACGCAGCAATGCCTCGCAATGGGCACGACATGAGGGG
AGATATGAAGATCCACCTCAGGTTACTTTCTATCCAGCAAGTCCTTCCCCTTCTTCTGCTTATGAATATGGCTACAGTAG
TCCTTTTCACGGGTCTCACGTTTCTGCATCAGAGCAGTCTTATTATCATCATCACCCAAACCAATTCAAGCAGTACGGAA
GAGAAGGCTGGTTTCAAGAATCTTCTGTTGCTTCACCTACTCGTTTTCCGGGTGAGACATCTGATGGAAAGAACTATCAC
AGGTCTTCTCAGTCTCAGCTGCATGATCTTCAGTATCATAATATTTATGAACCCAGTAGCTCTGTAATCCCACATCACTC
TGTGTACTCTGAGCGTAATTATGTAGCAGCTGCAGCGCCACACCACTCTACATACTCGGAGCATTCCATAGGGATTTCTA
AGAGTGACACAAGTAGTGAAAATATCTCATTAAGGAACAAAAAACGGTATGTCAGGGAAAGGAATCCGGTGGTGAAGCGC
CATATTCTTCCTTCAGCAGGCGGTGCACCTTTTGCAACTTGTTCCTATTGCTTGGAACTTCTACATCTTCCTCAGGTGTC
TCCCCAAGGAAAACGTAAAAGATATCAAGTGAGATGCGGCAGTTGTTCCGGTGTACTTAAGTTCTCTATTCGAGAGAAAG
CAGATACTGTCCTGGATTCACCTAGCTTTGTGGATTATGGCATGGATTTTGCAGATGAGAATGTTACTAATCATCAGGAT
TCAGCATCAGAAGGTTATGAAGAGATTTATCCTGATGGAAATCATCTGCCGTGTTTAGACGACGATTTTGGAGATACAAT
CTGCAAAAGCAACGATGCTGTTATTTTGAGTCAAAGTCTAGAAACATTTGAGGATAAGGGGATTAAAGAAGACATGAGGA
ATATATCCGGCAAACTATTAGATTTGAAATTGGAGGCATTGCAGCCTCATCTAAAACCTGTGGTGAACCCCAGATTAAGG
GAGCAACAACCTGCATCAAGTGAGACTATTGGAGAGACTTCCAGGATTCATCTAGAGCAATCTCAGGAAGCTCATTCAGA
AAAGTCAACCGAGATGGATAATAACAATTGTGAAAGAGCCTGGTGCGATTTAGAAGAGCTTGAATATGAGAAGAACGAAA
TTATTAAGCCAGAAGAAATTGTAGGAGAAGGATCAGGTGAGTCCTTCGAAGTTCCAGTATACCAGAACGAAAGGATGAGT
GAATCAAGTGAAGAAGATGAGAGAGTTGCAGAGAGATCGGTATCTCATAGTGTGGAAATTCTATACGAGAACGAATACGT
CAGTGAAACACGTGTACAGTCTGAGAATACCGGAGACGCTAACGAGTCTGAGTGGGAGGAGACTCAAGAAAATGAAGAAT
ATGGAGGTGAAAGTACATTGAAAGAGAACGGAGACAAACCGCAGTTGCATTTGGAGAAATATAGGTACATTCGAGATTCT
ATCTGTGACAGCAGCTTAAGCTATGGTGAACCATTTGAGGATACATCAGTCAAGGAAGATACGGAGCACATATCAAACAC
AATTTCAGATGATAACTCTTTGGTGAATGAGAATCAGAGGTTTATAGGACATCCTGACCAATCAGGTGAAGCTACAGTAA
CAATATCTAGTATCCAGGAGCAGTCCAAGTATGAGTATGAGAATTTAAGCGAAAGACAAGAATTGGAAATGACCATTAGT
GACAGAGTACGGTATGAGTTAGAGGAGTCTAGATACGAGACAAATGAAACTCTTGAGCCGAGCAAGGTGGTCGAAGATGG
ATCTGTTGTTTCTTTCGCGAAGGCGAGTGAGGCATTCGAAACAATCATAGAAGGCGAGACAGGTGGCGAGAGACTGGTAT
CTCATCAAATGGATTCTCCAAACGAGAAAGTAGAAAATTCTTATGGAACACTAGAACCAGTTTATCTAGAAGAAAGCGGG
TTTGCAGGTGAAAATACGTGGGAAGGGACAATATATGATAGAGCGGCGTTGCATTTGGAGGAATATGAAAGCAACTATGA
GAATTACAGCAGACCATTTGAATGGACTTCAGAAACAGCTCCAACATTTGGCATGCATGATTATGAGCTAGGGACAATAC
TTGAACCAGACGAGGATGCTGATGGAAGATCAGAATCCAGTTCACGGGGTTCCTTCAATGATGATGGAAGTTCAGAAGAG
AGGGTCATTTTTCATGATTCTCAAGATGCTATACCCGAGCAGTCCCACGATGAGCATGAGAGCTCAAGCAAAAGACAAGA
GTTGAGTGACACCGTTTTTGACATAGTAAGGTCTGAATTACAGGAGTATAGATATGAGACCAATGAACCACTTGAGCCAA
GCAAGATGGTTGGAGATGAATCTGTTGTTCCTGTTGAGAAGGCGGGTGAAACTTTCATAAGCGAAAAGGATGAAGAGAAC
TCGGTATCTCATCAAATGGAGTCTCAAAATGAAGATATGGAAAATTCCTACGGAACTATAGAACCTGTTTATCTGGAAGG
AAGCAGATGTGAAAGAGAAAATCCATGGGCAGAAACAATGGGAGATGGAGTGGGGTTGAAGTTAGAGGAATATAAAAGCT
ATCCCTTTGAATGGACTTCCGAACGAGCTCCAGCATTTCATCTGCATGAGTATGAACAATGGACAGTGCCTGAACCAGAA
GAGGATGCTAATGGAAGATCAATACCCAGTTCACGGGATTCCTTTAATGACCATGAAAGTTTAAAAGAGAAAGTTGTGTC
TCATGAGGAGGAGCCCTGGCTACTGGATGAGAACAAAACGGAAGCACTAAAAGTTGGTGTAATGGTGGAAGATGGACCTT
CGCTTCACCTGACGAAATGCGAAAATGAATCAATGAAATTGGAAGAGACACTTGAATGGACTTCAGAAAGAGCTCCAACA
TTTCGTCTGCATGAGTATGAACTAGGGGAAATGCTTGAATCAGACAACGATGTTGATGAAAGATCAGATTACAGTTCAAG
GGGTTCCTTCAATGACCATGGAAATTCAAAAGAAAGAGAGTTGTTCAATGAGGAGGAGCCCCAGCTGGTGATTGACGGCA
GAACCGAAGCGCTACAAGTAGGCCAAATGGCAAAAGATACGGTATCACTGCACTTGGAGGAATGCGGAGATGAATCAATG
AAACTGGATGAGACATTTGAATGGACTTCAGGGAGAACTTTAACGTTTCGTCGCCATGGGTATGAGGTAGGGACAAAGCT
TGAACCAGACGAGGATGCTGATGGAAGATCAGAATCTAGTTCAAGGGGTTCCTTCAATGAACGTGGAAGTCCAAAAGAAA
GAGCTGTACTTCACGAGGTTGGGCCTTGGCTGGTGGATGATTATGAAAACAACGCACTAAAAGTAGGTGTAATGGCAGAA
GATGGATCGCTGCACTTGGAGAAGTGCGAAAATGGAAAAATGGAATTGGACGAGACACTTGAACCAAGCGATGATATATT
CAGGCTCAGTCTTGATGACACACTTGAGCAAGAAAGGATGACGTTTCATTTAAAGATGTCTCAAGATAAGCAAGAAAATC
TAAGGCATACCTTTAAACAAGGTGAGGCTGAAAAAGATGTACCAGGATTTGGTTCAAGGGTATCTTCGGAGGGCCATGAA
TCTCCAAGTAAAATGGCAGAACTAGATAGTGACACTGAAGAGGAGATACTGGGAGACCACTTAGAACATTTGCAGAAACA
GAATGAGAAGTCAGGTCTAACCTTTGAACCACATGCTCATATCTACAGCACAACGGAGCCTTCTGAAATTGTGGGTTTGC
GTCATGCGTTATATCAAACACAAAATTCACCTCTACGGTCACCTCTCACTTCACCAATTCATACTCCCATTAGTTCTCCG
CTGCATTACCTGATGGCTTCACAAATACGTTCTCCAATAGCTTCACCAATGCATTCCCACATAGTTTCACCACTGCGTTC
TCCCATCAACTCATCTGGATCACTCTCTGATGTATTGCTCTTCAGCAAGAAAACTTGA