Details for Lyrate rockcress Locus 16039232

Position : sca3 ( 5`- 7595302 .. 7596497 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479261 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039232

Protein [Map View]
MALQWLILSYVVAAEVAIAVILTLPYPMLMKKRIVSLVSLILNPAASIVAFAGFQLLDIYWKNEHRLLCSSEVCTTTERD
RYEKSIYKAQRNGVLCAAGILLYWCIFRICKYHKDLERLEELEKRYKDE*

DNA
ATGGCATTGCAATGGCTTATTCTGTCGTATGTGGTCGCCGCCGAGGTCGCGATCGCCGTCATCTTGACTCTCCCTTACCC
AATGCTCATGAAGAAACGCATTGTATCACTTGTCTCGCTCATACTCAATCCTGCCGCTTCCATCGTCGCCTTCGCTGGAT
TTCAACTCCTCGATATTTACTGGAAGAATGAGCATAGGCTACTGTGCTCATCTGAAGTTTGCACTACTACAGAGCGGGAT
CGTTACGAGAAATCCATCTATAAGGCTCAGAGGAATGGGGTTCTGTGTGCGGCTGGGATCCTGCTCTACTGGTGCATCTT
CCGCATCTGCAAGTACCACAAAGACCTTGAGCGTTTGGAGGAATTAGAGAAGAGATACAAAGACGAGTAG