Details for Lyrate rockcress Locus 16039193

Position : sca5 ( 5`- 17885168 .. 17884350 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039193

Protein [Map View]
MGLRALPIQHNSGFISTTKVPISRTSPRFSRNPRWVVVSAKQEKDDEKKKEEETSLFTKLTDALDFSQVRSEKDAELLYE
AREATKSGGKMTQEQYEALRRKIGGTYKDFFKSYVEVDGKYVEEGWVDKTCKICKKDTKGEARQVDKLGRYAHVSCLQNP
PSGNFFTRLFSR*

DNA
ATGGGTCTTAGAGCACTGCCTATTCAACACAACAGTGGATTCATCTCTACGACCAAAGTCCCGATCTCAAGAACCTCGCC
GAGATTTAGCCGGAACCCTAGATGGGTCGTTGTCTCAGCAAAGCAAGAGAAAGATGATGAGAAGAAGAAGGAAGAGGAGA
CTTCGTTGTTTACGAAATTAACTGATGCGTTGGACTTCTCACAAGTTCGGTCGGAGAAAGACGCTGAGCTTCTCTACGAG
GCTCGAGAAGCCACCAAATCTGGTGGCAAGATGACCCAAGAACAGTATGAGGCATTGAGGAGAAAAATCGGAGGGACATA
CAAGGACTTTTTTAAATCCTACGTTGAAGTGGATGGGAAATATGTGGAGGAAGGATGGGTGGACAAAACATGTAAGATAT
GCAAAAAGGACACAAAGGGTGAGGCAAGACAAGTGGACAAGTTAGGGAGATATGCTCATGTCTCTTGTCTTCAAAATCCT
CCCTCTGGAAATTTCTTCACCAGGCTCTTCTCTAGATGA