Details for Lyrate rockcress Locus 16039168

Position : sca3 ( 5`- 4324086 .. 4325090 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039168

Protein [Map View]
MREDDSDWFARWEEELPSPEELMPISQSLISPDLALAFDIRSPNHGNGNSNQPHHHQTTPPTPSQLQLPSSQANSSAEFA
ADSADLGSGAAGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYLKRMQ
GLSSGGGAGSDPATDRLFASSPVPAHFLHPNRVPSSDHFMPSFVPIATLQQQQQMAAAAAAAAAAANPHLQPPQFHRQIA
AAHFGSPTNGGFSSPTNGQFGSPASNGFGSPTANGKFDPSFLAVRQTPQQQQQPIHRMSTPSLHSPVGNYVEDLESANAN
GGRTVLTLFPTRDD*

DNA
ATGAGAGAAGACGATTCAGACTGGTTCGCAAGATGGGAAGAGGAACTTCCATCACCAGAAGAGCTCATGCCAATTTCTCA
ATCTCTAATCTCACCCGATCTAGCTCTAGCCTTCGATATACGAAGCCCAAATCACGGAAACGGAAACTCAAATCAACCCC
ATCATCACCAAACCACACCTCCTACACCATCTCAGCTTCAGCTTCCATCTTCACAAGCCAATTCCTCAGCCGAATTCGCT
GCAGATTCAGCAGATCTAGGCTCAGGAGCTGCCGGAGATGAACCTGCACGAACCTTAAAACGACCGCGTCTTGTCTGGAC
ACCGCAGCTTCATAAACGTTTCGTTGATGCTGTTGCGCATTTAGGGATTAAGAACGCTGTTCCTAAAACGATTATGCAGC
TTATGAGTGTTGATGGTTTAACTAGAGAAAACGTTGCGAGTCATTTGCAAAAGTATAGACTTTATCTTAAGAGAATGCAA
GGTTTGTCTTCTGGTGGTGGAGCTGGTTCAGATCCGGCTACTGATCGTCTCTTCGCTAGCTCTCCGGTTCCTGCTCATTT
TCTTCATCCTAATCGTGTTCCCAGTTCTGATCATTTCATGCCGTCTTTTGTTCCCATTGCTACTCTTCAACAACAACAAC
AAATGGCTGCTGCGGCTGCCGCGGCTGCAGCAGCGGCTAATCCTCATTTACAACCGCCTCAGTTCCACCGACAAATCGCA
GCTGCGCATTTTGGCTCGCCGACAAACGGTGGATTCAGTTCACCGACGAATGGTCAATTTGGATCACCGGCTAGTAATGG
GTTTGGATCACCGACGGCGAATGGGAAGTTTGATCCTTCGTTCTTGGCGGTGAGGCAAACGCCGCAGCAGCAGCAGCAAC
CAATTCACAGAATGTCTACACCATCATTGCATAGTCCAGTTGGTAATTACGTTGAGGATTTGGAATCTGCAAACGCTAAT
GGAGGGAGAACTGTCCTAACTTTATTCCCAACTCGAGACGATTGA