Details for Lyrate rockcress Locus 16039162

Position : sca1 ( 5`- 7807014 .. 7808054 -3` )
Annotation : [B2G] sulfotransferase family protein
External links : CoGe
PGDD synteny : 16039162

Protein [Map View]
MEAKTINDAVVSESNHELAFSSPSEFEKNQKHYQEIIAKLPHKDGWRPKDPFVEYGGHWWLQPLLEGLLHAQNFFKARPN
DFFVCSYPKTGTTWLKALTFAIANRSKFDDSTNPLLKRNPHEFVPYIEIDFPFFPSVDVLKDQGNTLFSTHIPYDLLPES
VVKSGCKIVYIWRDPKDTFVSMWTFAHKERSQQGSLICLEEAFDKYCQGLSAYGPYLDHVLGYWKAYEANPNQILFLKYE
TMRADPLPYVKRLAEFMGYGFTKEEEEEKVVEKVVKLCSFETLKNLEANKGEKDREDRPAVYANSAYFRKGKVGDWQNYL
TPEMVARIDGLMEEKFKGTGFLTSTT*

DNA
ATGGAAGCAAAAACCATAAACGACGCCGTCGTATCAGAGTCGAATCACGAGTTAGCATTTTCGTCGCCATCAGAATTCGA
GAAGAACCAGAAACATTACCAAGAAATCATCGCTAAGCTTCCTCACAAAGATGGCTGGAGACCAAAAGATCCTTTCGTCG
AGTACGGTGGTCACTGGTGGCTACAACCTCTCCTTGAAGGTTTACTTCACGCCCAGAACTTCTTCAAGGCACGACCCAAT
GATTTTTTCGTCTGCAGCTACCCAAAAACCGGCACCACTTGGCTCAAAGCCTTAACTTTCGCAATCGCGAATCGCTCCAA
GTTCGACGATTCAACAAACCCTCTTCTCAAACGCAACCCACACGAGTTTGTCCCTTACATCGAAATCGATTTCCCGTTTT
TCCCAAGTGTTGATGTTCTTAAAGACCAAGGAAACACGCTTTTCTCGACTCATATCCCTTACGATCTCTTGCCTGAATCA
GTTGTGAAGTCCGGTTGCAAGATTGTTTACATATGGAGAGACCCAAAGGACACGTTTGTGTCGATGTGGACTTTTGCTCA
CAAGGAGAGATCACAACAAGGATCACTCATTTGCCTTGAGGAAGCTTTTGATAAGTACTGTCAAGGTTTATCTGCTTACG
GTCCTTATCTTGATCATGTTTTAGGGTATTGGAAAGCTTACGAAGCAAACCCAAATCAGATTTTGTTTCTCAAGTATGAG
ACTATGAGAGCTGATCCATTGCCATATGTGAAGAGATTAGCTGAGTTTATGGGTTATGGATTCACAAAGGAGGAAGAGGA
GGAAAAGGTTGTTGAGAAAGTTGTGAAGCTTTGTAGCTTTGAGACTTTGAAGAATCTTGAAGCTAATAAAGGTGAGAAAG
ATAGAGAAGATCGTCCTGCTGTTTATGCTAACAGTGCGTATTTCAGGAAAGGGAAAGTTGGGGATTGGCAGAATTATCTG
ACCCCGGAGATGGTGGCTCGTATTGATGGATTGATGGAAGAGAAGTTTAAAGGAACTGGCTTTCTTACTTCAACAACATG
A