Details for Lyrate rockcress Locus 16039153

Position : sca3 ( 5`- 9744246 .. 9745245 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039153

Protein [Map View]
MSSSFVTKRLFSVPILAMVAMQLSFVQCVLSLNQTNEYLHHICLNRQGTYKSGSKDERDLNNLIQMISISILGDVVVFSG
DNSIYVKLQCRGDSSTSKCRSCLDTAFSGKMSQQQRIIWYDNCVLTILTFHTYGKIDYQNNFYISNAKDVSGDTNSFNEK
TRALLYKLKEKASSKENIPNKKNYLYATGEESLGKMKLYAMVQCTQDLSIKNCSVCLNWILAKFPKCCNGKQGGRFLSTS
CNFRYELYPFVKLTTS*

DNA
ATGTCTTCATCCTTTGTAACAAAACGACTCTTTTCGGTCCCTATCTTGGCCATGGTGGCCATGCAACTCTCTTTTGTACA
GTGTGTTTTGTCCCTAAACCAAACAAATGAGTATCTACACCACATATGCCTTAATCGTCAAGGAACATACAAGTCAGGTA
GTAAAGACGAGAGAGATCTTAACAATCTCATCCAAATGATTTCTATCTCAATTTTAGGCGACGTTGTCGTTTTTAGCGGT
GATAATTCCATCTACGTCAAGCTCCAGTGCCGGGGGGACTCCTCCACATCCAAGTGCCGCTCTTGCCTTGATACCGCCTT
CTCTGGGAAGATGTCCCAACAACAAAGAATAATATGGTACGACAACTGTGTTCTCACAATTTTAACGTTTCATACGTATG
GCAAGATCGATTACCAGAACAATTTCTATATTTCCAATGCAAAGGATGTGAGCGGTGATACAAATTCGTTCAACGAGAAG
ACGAGGGCTCTCCTCTATAAGCTGAAGGAGAAAGCAAGTAGTAAAGAAAACATCCCCAACAAGAAAAATTACTTATATGC
AACAGGGGAGGAAAGTCTCGGGAAGATGAAATTGTACGCAATGGTGCAGTGTACACAAGACTTATCAATAAAAAATTGTA
GTGTGTGTTTGAACTGGATTCTTGCGAAGTTTCCCAAATGCTGCAACGGTAAACAAGGAGGAAGATTTTTGAGTACAAGT
TGTAATTTTAGGTATGAGCTTTACCCCTTTGTAAAACTTACGACTAGTTAA