Details for Lyrate rockcress Locus 16039125

Position : sca3 ( 5`- 1348359 .. 1346950 -3` )
Annotation : [B2G] ANAC047 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039125

Protein [Map View]
MISKDPRSSLPPGFRFHPTDEELILHYLRKKVSSSPVPLSIIADVDIYKSDPWDLPAKAPFGEKEWYFFSPRDRKYPNGA
RPNRAAASGYWKATGTDKLIAVANGEGFHENIGIKKALVFYRGKPPKGVKTNWIMHEYRLADSLSPKRISCSRSSSSEVN
NNFGDRNLKSKEYSMRLDDWVLCRIYKKSHASLSSPDVALVTSNQEHEENDNEPFVERGTFLPNLQKDQPLKRQKSSCSF
SNLLDATDLTFLANFLNETPENRSESDFSFMSGNFSNPDIYGNHYLGQKLPRLSSPTSETSGVGNKRERLDFAEETINAS
KKMMNTYSYNNNIDQMDHSMMQQPSFLNQELLMSSHLQYQG*

DNA
ATGATAAGCAAGGATCCAAGATCGAGTTTACCTCCAGGGTTTCGATTTCATCCAACAGATGAAGAACTCATTCTCCATTA
CCTAAGGAAGAAAGTTTCCTCTTCCCCGGTCCCGCTTTCGATTATTGCCGATGTCGATATCTACAAATCCGATCCATGGG
ATTTACCAGCTAAGGCTCCATTTGGAGAGAAAGAGTGGTATTTTTTCAGTCCGAGGGATAGGAAATATCCTAACGGAGCA
AGACCAAACAGAGCAGCTGCGTCTGGATATTGGAAAGCAACCGGAACTGACAAATTAATTGCGGTAGCGAATGGTGAAGG
GTTTCATGAAAACATTGGTATAAAAAAAGCTCTTGTGTTTTATAGAGGAAAGCCTCCAAAAGGTGTTAAAACCAATTGGA
TCATGCATGAATATCGTCTTGCCGACTCTTTATCTCCCAAAAGAATCAGCTGTTCTAGGAGCAGTAGTAGCGAAGTCAAT
AATAATTTTGGAGATAGGAATTTGAAATCCAAAGAATATTCGATGAGGCTGGATGATTGGGTTCTTTGCCGGATTTACAA
GAAATCACACGCTTCATTGTCATCACCTGATGTTGCTTTGGTCACAAGCAATCAAGAGCATGAGGAAAATGACAACGAAC
CATTCGTAGAGCGCGGAACCTTTTTGCCAAATTTGCAAAAGGATCAACCCCTTAAACGTCAGAAGTCTTCTTGTTCATTC
TCAAACTTATTAGACGCTACAGATTTGACGTTCCTCGCAAATTTTCTAAACGAAACCCCGGAAAATCGTTCTGAATCGGA
TTTTTCTTTCATGAGTGGCAATTTCTCTAATCCTGACATCTACGGAAACCATTACTTGGGTCAGAAGTTACCACGGTTGA
GCTCTCCTACTTCAGAGACAAGCGGCGTCGGAAACAAAAGAGAGAGACTAGATTTTGCGGAAGAAACGATAAACGCTTCG
AAGAAGATGATGAACACCTATAGTTACAATAATAATATAGATCAAATGGATCATAGTATGATGCAACAACCTAGTTTCCT
GAACCAGGAACTCTTGATGAGTTCTCACCTTCAGTATCAAGGCTAG