Details for Lyrate rockcress Locus 16039121

Position : sca3 ( 5`- 825774 .. 824424 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477542 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039121

Protein [Map View]
MGKNKQNGESDNKSEKKNQKNGDSSVDKSDKKNQCKQIVLKVYMHCEGCASQVSHCLRGYDGVEQIKTEIGDNKVVVSGK
FDDPLKILRRVQKKFSKNAELISPKPNPKQDHQKEPQQKKESAPQIKTAILKMNMHCEGCVHEIKRGIEKIKGIQSVEPD
RSKSTVVVRGVMDPPKLVEKIKKKLGKHAELLSQTREKGKDNNNNNHKNEDSDGNKIFSYPPQYSSQHAYPSQIFSDENV
HSCSIM*

DNA
ATGGGAAAGAACAAGCAAAATGGAGAATCAGATAACAAGTCAGAAAAGAAGAACCAGAAAAATGGAGATTCATCAGTCGA
TAAGTCTGATAAGAAAAATCAATGTAAACAAATTGTTCTGAAGGTTTACATGCACTGTGAAGGATGTGCATCACAAGTTT
CTCATTGCTTGAGGGGCTACGATGGGGTTGAGCAAATTAAGACAGAGATCGGAGACAATAAAGTGGTTGTGTCTGGAAAA
TTTGATGATCCGTTGAAGATATTACGAAGAGTGCAAAAGAAATTTAGTAAAAATGCTGAGTTGATTTCCCCAAAACCTAA
CCCCAAACAAGATCATCAGAAGGAGCCACAACAAAAGAAAGAAAGTGCTCCCCAGATCAAAACTGCAATTTTAAAAATGA
ACATGCACTGTGAAGGATGTGTTCATGAAATCAAAAGAGGCATTGAGAAAATAAAAGGTATTCAATCGGTGGAACCAGAC
CGGTCAAAGTCAACAGTAGTGGTACGAGGAGTCATGGATCCTCCAAAACTTGTGGAGAAAATCAAGAAAAAGCTTGGGAA
ACACGCAGAGCTTCTAAGTCAAACCAGAGAGAAAGGCAAAGACAATAATAATAATAATCATAAGAATGAAGACAGTGATG
GAAACAAAATCTTTAGTTACCCTCCTCAGTATTCATCCCAACATGCTTATCCCTCTCAGATCTTTAGCGACGAAAATGTA
CATTCCTGTTCGATCATGTGA