Details for Lyrate rockcress Locus 16039111

Position : sca3 ( 5`- 11195662 .. 11201625 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898932 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039111

Protein [Map View]
MATKLPLQNSNNANVAKAPRGAAAGKTIEEMYQKKSQLEHILLRPDTYIGSIEKHTQTLWVYEKDEMVNRSVTYVPGLYK
IFDEILVNAADNKQRDPSMDSVQVVIDVEQNLISVCNSGAGVPVEIHQEEGIYVPEMIFGHLLTSSNYDDNVKKTTGGRN
GYGAKLTNIFSTEFIIETADGKRLKKYKQVFENNMGKKSEPVITKCNKSENWTKVTFKPDLNKFSMTELEDDVVALMSKR
VFDIAGCLGKSVKVELNGKQIPVKSFTDYVDLYLKAANKLRADPDPLPRITEKVNDRWEVCVSLSEGQFQQVSFVNSIAT
IKGGTHVDYVTSQITNYIVGVVNKKNKNANVKAHNVKNHLWVFVNALIDNPAFDSQTKETLTLRQSSFGSKCELSEDFLK
KVGKSGVVENLLSWADFKKSKDLKKSDGAKTGRVEVEKLEDAAEAGGKNSRLCTLILTEGDSAKPLALAGRTVLGENYYG
VFPLRGKLLNVREASTTQITNNKEIENIKKILGLKQNMKYDNVSSLRYGHMMIMTDQDHDGSHIKGLLINFIHSFWPSLL
KVPSFLVEFITPIVKAKNKAKKKVLSFYSMPEYEDWKESMKGNATGWEIKYYKGLGTSTTEEAKEYFKNLGLHKKDFVWE
DEQDGEAIELAFSKKKIEARKNWLSNYVPGTHLDQREPKVTYSDFVNKELILFSMADLQRSIPSMVDGLKPGQRKILFTA
FKKIVVKEMKVAQLVGYVSSMSAYHHGEQSLASAIIGMAQDYVGSNNINLLQPNGQFGTRNSGGKDAASARYIFTILSPV
TRILFPKDDHILLDYLNEDGQSIEPTWYMPIIPTVLVNGSEGIGTGWSTFIPNYNPREIVANVRCRLNGESMVPMDPWYR
GFKGTIEKTASKEGGCTYTITGLYEEVDDTTIRITELPIRRWNDDYKQFLQSLKTDNGAPFFQDVKAYNDDKSVDFDLIL
SEENMLAARQEGFLKKFKLTTTIATSNMHLFDRKGVIKKYATPEQILEEFFELRLEYYEKRKETMLKNLEIELLKLENKV
RFILGVLSGEIIVNNRKKADIVEDLRQRGFTPFPKKAESVEAAVAGAVDDAAEESEEILVDPESSSTYIPGSEYDYLLAM
AIGSLTIEKVQELLADRDKMIIAVEDMKKHTPKSLWLRDLESLDKELDKLDRKDAKAEEERKAAQEKIRKKSGAPVKVKR
QAPKKPAPKKTTKKASESETTESSYSAMDTDNNVAEVVKPKGRQPAKKKAPAAKEVEEDDMLDLAQRLAQYNFGSAPAES
SKTTETSKAIDVDDDDDEVVEVAPAKKGGRKPAASKAAKPPAAPRKRGKQTVTSTEVVAIGVSPEKKVRKMRSSPFNKKS
SSVMSRLANNKEEESSENVAGNSSSEKSGDVAAKSRPQRANRRKMTYVLSDSESESANDSEFDDIEDDEDDE*

DNA
ATGGCTACCAAACTCCCTCTTCAAAACAGCAACAACGCCAATGTTGCGAAAGCTCCGCGAGGCGCCGCCGCCGGGAAGAC
GATCGAGGAAATGTATCAGAAGAAATCGCAGCTTGAGCACATTCTGCTCCGTCCTGATACATACATCGGATCGATTGAGA
AACACACCCAGACGCTTTGGGTTTATGAGAAAGATGAGATGGTGAATCGTTCTGTTACCTATGTACCTGGATTGTATAAG
ATCTTTGATGAGATTCTTGTGAACGCTGCTGATAACAAACAGAGAGATCCGTCGATGGATTCTGTTCAAGTTGTGATTGA
TGTTGAGCAGAATCTGATTAGTGTTTGTAACAGTGGAGCTGGAGTTCCTGTAGAGATACATCAGGAAGAAGGTATTTATG
TACCGGAGATGATATTTGGTCATTTGTTGACGAGTAGTAACTACGATGATAATGTGAAGAAGACCACTGGTGGAAGAAAC
GGATATGGTGCTAAGCTTACTAATATTTTTTCTACTGAATTCATCATTGAGACTGCAGATGGGAAGAGACTCAAGAAGTA
TAAGCAGGTCTTTGAGAACAATATGGGGAAGAAGTCGGAACCAGTTATAACAAAGTGCAATAAGAGTGAAAACTGGACAA
AGGTTACATTCAAACCAGATTTGAACAAGTTTAGCATGACTGAATTAGAAGACGATGTGGTTGCTCTAATGAGTAAGCGA
GTGTTTGATATTGCTGGATGTTTGGGGAAGTCTGTCAAAGTTGAGCTGAATGGGAAACAAATACCAGTGAAGTCATTTAC
TGATTATGTTGATCTATACCTAAAAGCAGCTAATAAGTTAAGGGCGGATCCCGATCCTCTCCCAAGGATAACTGAGAAAG
TTAATGACAGATGGGAGGTTTGTGTGAGCTTAAGTGAAGGACAGTTTCAGCAGGTCAGCTTTGTCAACTCCATAGCAACA
ATCAAGGGTGGTACACATGTTGATTATGTGACGAGTCAGATCACAAACTATATTGTGGGTGTTGTGAACAAAAAGAATAA
AAACGCTAATGTTAAGGCCCATAATGTGAAGAACCATCTGTGGGTCTTTGTTAATGCATTGATTGACAATCCTGCTTTTG
ATTCTCAAACAAAAGAAACACTGACTCTTCGACAGAGCAGTTTCGGGTCGAAATGTGAACTTTCAGAAGATTTTCTGAAG
AAAGTTGGAAAATCTGGCGTAGTGGAGAATTTGCTTTCATGGGCAGATTTCAAGAAGAGCAAAGATCTAAAGAAAAGTGA
TGGAGCCAAAACAGGGAGGGTTGAAGTTGAGAAGTTAGAGGATGCCGCCGAAGCTGGAGGGAAGAACTCTCGACTCTGTA
CGTTGATTTTGACTGAAGGAGACTCAGCCAAACCTCTAGCTCTGGCGGGGAGGACTGTCTTGGGTGAGAACTATTACGGT
GTGTTTCCGCTTCGAGGAAAGCTATTGAATGTCAGGGAAGCCAGCACCACTCAGATTACAAACAATAAGGAAATTGAGAA
CATCAAGAAGATCCTTGGACTAAAGCAAAATATGAAGTACGACAATGTTAGCTCATTAAGATATGGCCATATGATGATCA
TGACTGATCAAGATCATGATGGTTCCCATATAAAGGGGCTCTTAATCAATTTTATCCACTCTTTCTGGCCGTCGTTACTC
AAGGTTCCATCATTCCTGGTTGAGTTTATAACACCCATTGTGAAGGCTAAGAATAAGGCTAAAAAAAAAGTTCTGTCATT
TTACTCAATGCCTGAGTACGAAGACTGGAAAGAAAGTATGAAGGGTAATGCAACCGGATGGGAAATCAAATACTACAAGG
GGTTGGGTACAAGTACAACTGAGGAGGCCAAAGAGTACTTTAAAAATCTTGGTCTTCACAAAAAGGATTTTGTTTGGGAG
GATGAACAAGATGGAGAAGCCATTGAACTTGCTTTCAGTAAAAAGAAGATCGAAGCCCGAAAAAATTGGCTTTCGAACTA
TGTGCCTGGCACTCATCTTGATCAGAGAGAACCAAAAGTTACGTACAGTGACTTCGTGAACAAAGAACTGATCTTGTTCT
CCATGGCGGATCTTCAACGGTCAATTCCCTCAATGGTTGATGGGCTCAAACCGGGTCAGAGAAAGATACTTTTCACTGCA
TTCAAGAAAATCGTAGTTAAAGAAATGAAGGTTGCCCAACTCGTGGGTTATGTATCATCTATGTCAGCTTATCATCATGG
AGAGCAGAGCCTTGCCAGTGCTATCATAGGCATGGCGCAGGATTACGTGGGCAGCAACAATATCAACTTACTTCAACCAA
ATGGTCAATTTGGTACACGAAATTCGGGTGGAAAAGATGCAGCTAGTGCAAGATACATTTTCACTATTCTCTCTCCAGTA
ACAAGGATCTTGTTTCCCAAGGATGATCATATCCTTCTTGATTACTTGAATGAAGACGGGCAATCGATAGAGCCAACTTG
GTACATGCCCATCATTCCAACTGTACTTGTCAATGGCTCTGAAGGCATTGGAACTGGGTGGAGCACGTTCATACCAAACT
ATAACCCTAGAGAGATTGTTGCTAATGTAAGGTGTCGACTTAACGGTGAAAGTATGGTGCCTATGGATCCTTGGTATAGA
GGTTTTAAAGGAACAATTGAGAAAACTGCGTCAAAAGAAGGTGGTTGTACCTACACAATCACTGGTCTATATGAGGAGGT
TGATGACACAACTATTCGAATTACGGAGTTGCCAATCAGAAGGTGGAATGATGATTATAAACAATTCTTGCAGTCATTGA
AGACAGATAATGGTGCCCCTTTTTTCCAGGATGTCAAGGCTTACAATGACGATAAATCTGTTGATTTTGACCTTATTTTG
AGTGAAGAGAACATGCTGGCGGCTCGGCAAGAGGGCTTTCTGAAGAAATTCAAACTCACCACGACAATCGCTACAAGTAA
TATGCATCTCTTTGATAGAAAGGGTGTCATAAAGAAATATGCGACTCCAGAACAAATCCTTGAAGAGTTCTTTGAACTCA
GGCTTGAATACTATGAGAAGAGAAAGGAAACCATGTTGAAGAATCTGGAAATTGAGCTGTTGAAACTAGAAAACAAAGTG
CGGTTTATTCTTGGAGTTCTCAGTGGAGAAATCATAGTGAACAATAGGAAGAAAGCCGATATTGTTGAGGACTTAAGACA
GAGAGGGTTCACACCATTTCCGAAGAAGGCCGAGTCTGTCGAAGCTGCAGTTGCTGGAGCAGTTGATGATGCAGCTGAAG
AATCTGAAGAAATCTTAGTGGATCCTGAATCAAGCTCCACTTATATACCCGGCTCAGAATATGACTACCTATTGGCAATG
GCTATAGGTTCGTTGACTATAGAGAAAGTTCAGGAGTTATTAGCAGACAGAGATAAAATGATTATAGCAGTTGAAGACAT
GAAAAAACACACACCGAAATCCCTCTGGCTCAGAGACCTAGAGTCTCTTGACAAGGAACTAGATAAACTTGATCGGAAAG
ATGCTAAAGCCGAAGAGGAAAGAAAGGCAGCACAGGAAAAAATCAGGAAGAAATCTGGAGCACCAGTAAAGGTTAAAAGG
CAGGCACCAAAGAAACCAGCACCAAAGAAGACCACAAAGAAAGCCAGTGAATCTGAAACAACAGAGTCTTCCTATTCAGC
AATGGACACAGATAACAACGTAGCAGAAGTGGTGAAGCCAAAAGGTAGACAACCAGCAAAGAAGAAGGCTCCAGCTGCAA
AGGAGGTTGAAGAGGATGACATGTTGGATCTAGCACAACGGCTTGCTCAATACAACTTCGGCTCAGCACCTGCGGAATCA
AGTAAAACAACTGAAACATCGAAAGCAATTGATGTGGATGACGATGATGATGAGGTAGTTGAGGTTGCACCAGCAAAGAA
AGGAGGAAGAAAACCTGCGGCAAGTAAAGCTGCAAAACCACCAGCAGCTCCGAGGAAGCGAGGGAAGCAGACGGTTACTT
CAACAGAGGTTGTGGCAATTGGTGTGTCCCCGGAGAAGAAAGTGAGGAAGATGAGATCATCTCCGTTTAACAAGAAGAGT
AGTTCAGTGATGAGCAGGTTGGCTAATAATAAGGAAGAGGAGAGCAGCGAGAATGTGGCTGGAAACTCATCGTCGGAGAA
ATCTGGAGATGTTGCTGCGAAATCGAGGCCTCAAAGAGCGAATAGAAGGAAAATGACTTATGTGTTGAGTGATTCTGAGA
GTGAATCTGCGAATGATTCTGAGTTTGATGACATTGAAGACGACGAAGATGATGAGTAA