Details for Lyrate rockcress Locus 16039110

Position : sca3 ( 5`- 592871 .. 590100 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039110

Protein [Map View]
MQLSPERCRPMSLTASEIKEACSANSDEMELLHGSNRLSSPEHVRRRVSGNSSAEGSPRICRQQSFGRDIGHAAAETYLI
TRLSFNLLGYLGVGYRWITRLLALACYAMLLMPGFLQVAYLYFFSSQVRRSIVYGGHPRNRLDLYLPPTNDGLKPVVVFV
TGGAWIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQGTISDMVSDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHIS
SCALFEQAIKESRRESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFEQFSPEVRLKDLSVRKA
AALLPYITLFHGSADYSIPPEASKTFTDALRAAEVKAELVMYKGKTHTDLFLQDPLRGGKDELFDHIVSMIHADDSYALR
NDAVAPPRKRLVPEFLLKLAGKVSPF*

DNA
ATGCAGTTGTCTCCGGAACGATGCCGTCCGATGTCTTTAACAGCGTCGGAAATCAAAGAGGCTTGCTCAGCGAATTCCGA
CGAAATGGAGCTGCTTCACGGCTCCAACAGGTTATCTTCACCGGAACATGTTCGTAGAAGAGTCTCTGGGAATTCTTCTG
CGGAAGGTTCGCCTCGAATTTGTCGGCAGCAGTCGTTCGGTCGCGACATAGGCCATGCAGCTGCCGAGACGTATTTAATT
ACTCGGCTTAGCTTCAACCTTCTTGGATATCTCGGGGTAGGTTACCGGTGGATCACAAGATTACTAGCTCTTGCTTGTTA
TGCAATGCTCCTTATGCCTGGTTTCCTTCAAGTTGCATATCTTTATTTTTTCTCATCTCAAGTCAGGAGGAGTATAGTTT
ATGGAGGTCATCCAAGGAATAGGCTGGATTTGTACTTACCGCCAACTAATGATGGCCTGAAGCCGGTTGTTGTTTTCGTG
ACTGGTGGAGCTTGGATTATTGGTTACAAAGCTTGGGGTTCTCTCTTGGGGCTGCAGCTAGCAGAAAGGGACATAATTGT
GGCATGTCTAGATTACAGAAACTTTCCTCAGGGCACAATTAGTGATATGGTAAGTGATGCCGCGCAAGGAATCTCATTTG
TCTGCAATAACATCTCTGCATTTGGAGGTGATCCTAACAGAATCTATTTGATGGGGCAATCAGCTGGTGCACATATCTCT
TCTTGTGCTCTCTTTGAGCAAGCTATTAAAGAATCAAGACGGGAGAGCATCTCATGGAGTGTATCTCAGATAAAAGCTTA
CTTTGGTTTATCTGGAGGGTACAATCTCTTCAATCTGGTTGAACACTTCCACAACCGGGGCTTGTATCGTTCAATTTTCC
TAAGCATAATGGAAGGAGAAGAGTCCTTTGAACAATTCTCTCCTGAAGTGAGATTGAAAGACCTGAGTGTAAGAAAAGCT
GCAGCCCTCTTACCTTATATTACACTCTTTCATGGATCCGCAGATTATTCAATTCCACCTGAAGCAAGCAAAACTTTTAC
AGATGCTCTTCGAGCTGCTGAAGTGAAAGCTGAGCTAGTTATGTACAAGGGTAAAACTCATACCGATCTATTTCTTCAGG
ATCCTCTGAGAGGCGGTAAAGATGAGCTATTTGATCATATAGTCTCTATGATACACGCCGATGACAGTTACGCATTGAGA
AATGATGCTGTTGCGCCACCGAGAAAACGGCTTGTTCCAGAGTTCTTGCTGAAACTGGCCGGCAAGGTCAGCCCTTTTTG
A