Details for Lyrate rockcress Locus 16039106

Position : sca3 ( 5`- 1943754 .. 1942375 -3` )
Annotation : [B2G] short-chain dehydrogenase reductase family protein
External links : CoGe
PGDD synteny : 16039106

Protein [Map View]
MASGFPPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGREDKDAD
ETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRIDVLVNCAAEQHEVSIEDIDEARLERVFRTNIFSQFF
LVNYRYALKHMKEGSSIINTTSVVAYAGHSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSEE
AIKQFGSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVNA*

DNA
ATGGCGAGTGGGTTTCCACCGCAGAAGCAAGAAACACAACCAGGGATACAACATGTCATGGAACCAACACCCGAGTTCTC
TAGCTCTAACTACAAACCTTCCAACAAACTTCATGGAAAAGTGGCGCTCGTGACAGGAGGAGACTCAGGAATAGGTAAAG
CAGTGTGTCACTGCTACGCACTTGAAGGAGCGAGCGTGGCTTTCACGTACGTGAAAGGTCGGGAGGACAAAGATGCAGAC
GAAACGCTGCGTTTGCTTCATGAGGTTAAAACAAGGGAAGCTAAAGAGCCGATCATGATCGCTACTGATTTAGGGTTTGA
AGAGAATTGCAAGAGGGTCGTTGAGGAAGTGGTGAATTCCTTTGGACGCATCGATGTGCTTGTGAATTGTGCAGCTGAGC
AGCATGAGGTTTCCATTGAGGATATCGATGAGGCTAGGCTTGAGAGAGTGTTTCGTACCAACATCTTCTCGCAGTTTTTC
TTGGTTAATTATAGGTACGCGTTGAAGCACATGAAGGAAGGGAGTAGTATCATCAATACGACGTCGGTTGTTGCATACGC
AGGACACTCAAGCTTACTAGAGTACACAGCTACAAAAGGAGCCATTGTTTCCTTCACTCGTGGCTTAGCTCTGCAGCTTG
CACCAAAGGGTATACGCGTGAACGGTGTCGCTCCTGGTCCGGTCTGGACTCCACTGATAACCGCATCGTTCTCTGAAGAA
GCTATCAAGCAGTTTGGGTCAGAGACACCGATGAAAAGAGCGGCTCAGCCTGTGGAAGTGGCTCCTTCTTACGTCTTCTT
GGCTTGTAACCATTGCTCTTCTTACTATACCGGCCAAATCCTTCATCCAAACGGTGGTCTTATCGTGAACGCTTGA