Details for Lyrate rockcress Locus 16039098

Position : sca5 ( 5`- 17899228 .. 17898247 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039098

Protein [Map View]
MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEAYTLPKLYAKMQYCVSCAIH
SHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQPGQAPRPAGGAPAAPRA*

DNA
ATGACTTTCAAGCGTAGGAATGGTGGCAGGAACAAGCATAACCGTGGTCATGTGAACCCAATCAGGTGTTCCAACTGTGG
AAAGTGTTGCCCCAAGGATAAGGCGATTAAGAGATTCATCGTCAGGAACATTGTTGAGCAGGCTGCTATTAGAGATGTGC
AAGAAGCTAGCGTCTACGAAGCTTACACTCTCCCAAAGCTTTACGCTAAGATGCAATACTGCGTCTCTTGTGCTATCCAC
TCTCACGTTGTTAGAGTCCGATCCCGCACTAACCGTAGGGTTCGTACCCCACCACCTCGTTTCGCCAGACGCAAGGAGGA
CACTCCCAAGCCTGGACAGCCTGGTCAGGCTCCTCGCCCTGCTGGTGGTGCTCCTGCTGCTCCTCGTGCCTAA