Details for Lyrate rockcress Locus 16039083

Position : sca3 ( 5`- 3552555 .. 3553700 -3` )
Annotation : [B2G] signal peptidase i family protein
External links : CoGe
PGDD synteny : 16039083

Protein [Map View]
MGIQNILWQVAKKSFTGSIIGLTISDRCCSVVPVRGDSMSPTFNPQRNSYLDDYVLVDKFCLKDYKFARGDVVVFSSPTN
FGDRYIKRIVGMPGEWISSSRDVIRVPEGHCWVEGDNKTSSLDSRTFGPIPLGLIQGRVTRVLWPPQRISKIGQ*

DNA
ATGGGAATCCAGAATATTTTATGGCAAGTGGCAAAGAAATCATTCACTGGAAGTATTATAGGGCTTACCATTTCAGATAG
ATGTTGTAGCGTTGTTCCGGTCAGAGGAGATTCCATGTCTCCCACATTCAATCCCCAGCGGAATTCTTATTTAGATGATT
ATGTACTCGTGGACAAATTTTGCCTTAAGGATTATAAGTTTGCGCGTGGTGATGTTGTAGTGTTCAGCTCTCCGACAAAT
TTCGGGGATAGATACATAAAGAGGATCGTCGGGATGCCTGGCGAATGGATAAGTAGTTCTCGGGATGTGATCAGAGTCCC
AGAAGGTCATTGTTGGGTAGAAGGAGATAACAAAACTTCCAGCTTAGACTCAAGAACCTTTGGCCCTATTCCTTTGGGTT
TAATTCAAGGAAGGGTCACTCGTGTCTTGTGGCCTCCTCAAAGAATAAGCAAGATTGGTCAGTAA