Details for Lyrate rockcress Locus 16039071

Position : sca3 ( 5`- 1651640 .. 1649667 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039071

Protein [Map View]
MCFVLLRRGIRLFGTECGSKTTTWDPVQSLQLNHQSLVLLENCSSRNQFKQVLAQIMRFNLIGVTFPMSRLIFFSAITYP
ENLDLAKLLFLDFTPNPNVFVYNTMISAVSSSKNECFGLYSSMIRYRVSPDRQTFLHLMKASSFLSEVKQIHCHIIVSGC
LSLGNYLWNSLVKFYMELGSLGFAEKVFAIMPQPDVSSFNVMIVGYAKQGFGLEALELYYKMVSDGIEPDEYTLLGLLVC
CGHLSDIRLGKGVHGWIERRGPVYSSNLILRNALLDMYFKCKESGLAKRAFDALKKKDMRSWNTMVVGFVRLGDMEAAQA
VFDQMPQRDLVSWNSLLFCYSKKGCDQRAVRELFYEMLIVEKVKPDRVTMVSLISGAANNGELSHGRWVHGLMIRLQLEG
DAFLSSALIDMYCKCGLIERAFMVFKTATEKDVPLWTSMITGFAFHGYGQQALQLFKRMQEEDVTPNKVTLLAVLTACSH
SGLVEEGLHVFYHMKEKFGFHPETEHYGSLVDLLCRAGRLEEAKDIVQNKMPMRPSQSMWGSILSACREGEDIETAELAL
SELLKLEPEKEGGYVLLSNIYATVGRWGYSDKTREAMESRGVKKTAGYSSVVGVEGVHSFVAAEKQNHPRWTEIKRILQH
LHNEMKSKIGSLDLLGT*

DNA
ATGTGCTTTGTGTTGTTGCGGCGAGGAATTAGATTGTTTGGCACAGAATGTGGGAGCAAGACAACAACATGGGATCCTGT
TCAATCACTTCAGCTGAATCATCAATCTCTTGTCTTGCTCGAGAATTGCAGTTCCAGGAATCAATTCAAGCAGGTTTTGG
CACAGATCATGCGTTTCAATCTCATCGGCGTTACGTTTCCCATGAGCCGTCTTATCTTCTTCTCGGCGATCACATACCCA
GAGAATCTCGACTTGGCGAAGCTTCTGTTTCTTGATTTCACTCCGAATCCGAATGTTTTTGTTTACAACACAATGATATC
TGCTGTTTCGAGCTCCAAAAATGAATGCTTTGGTCTGTATAGTTCTATGATTAGGTACCGTGTTTCTCCGGACAGGCAAA
CGTTTCTCCATCTCATGAAAGCTTCGAGTTTTCTGTCGGAAGTGAAGCAGATCCATTGTCATATCATTGTTTCTGGGTGT
TTGTCTCTTGGGAATTACCTGTGGAATTCTCTGGTTAAGTTTTACATGGAGTTGGGAAGTTTGGGTTTTGCCGAGAAGGT
GTTTGCTATAATGCCTCAACCAGATGTCAGCTCTTTTAACGTTATGATTGTTGGTTATGCGAAGCAGGGGTTTGGTTTAG
AGGCACTGGAACTGTATTATAAGATGGTTAGTGATGGTATTGAACCTGATGAGTACACACTGCTGGGTCTTCTAGTTTGT
TGTGGTCATTTATCAGATATTAGGCTTGGGAAGGGAGTTCATGGTTGGATTGAGAGGAGAGGACCTGTTTATTCATCTAA
TTTGATTCTGCGCAATGCTCTTTTGGACATGTATTTCAAATGCAAAGAATCCGGACTTGCTAAAAGAGCTTTTGATGCGT
TGAAGAAGAAAGACATGCGCTCTTGGAACACCATGGTTGTTGGGTTTGTTAGGCTTGGGGACATGGAAGCTGCTCAGGCT
GTTTTTGATCAGATGCCCCAAAGGGATCTCGTTTCTTGGAATTCTCTGCTTTTTTGTTACTCGAAGAAGGGATGTGACCA
AAGAGCCGTCAGAGAATTGTTCTATGAAATGCTGATCGTGGAGAAGGTCAAGCCAGACCGCGTCACTATGGTTAGTTTGA
TAAGTGGTGCAGCAAACAACGGAGAACTGAGCCATGGAAGATGGGTGCACGGATTAATGATCCGTCTGCAACTGGAAGGT
GATGCCTTTCTGAGTTCGGCTCTGATAGATATGTACTGCAAATGTGGTCTCATTGAGCGGGCTTTCATGGTTTTCAAGAC
AGCTACTGAGAAAGATGTTCCGCTATGGACATCAATGATAACTGGGTTTGCCTTCCATGGATATGGCCAACAAGCTCTGC
AGCTATTCAAAAGAATGCAAGAAGAAGATGTGACGCCAAACAAAGTCACTCTGCTCGCTGTCCTGACAGCTTGCAGTCAC
AGCGGACTTGTGGAGGAAGGGCTTCACGTTTTCTACCACATGAAGGAAAAATTCGGCTTTCACCCTGAAACCGAGCATTA
CGGAAGCCTTGTGGATCTGTTGTGTAGGGCAGGGAGATTAGAGGAAGCGAAAGACATAGTGCAAAATAAGATGCCAATGA
GACCGAGTCAGTCAATGTGGGGATCGATCTTAAGCGCTTGTCGGGAAGGTGAAGACATTGAAACCGCAGAGTTGGCTTTA
TCGGAATTGCTTAAGTTGGAACCTGAAAAAGAAGGCGGATATGTTTTGTTGTCTAATATATATGCAACCGTTGGAAGATG
GGGATATTCAGACAAGACGAGAGAAGCAATGGAGAGTCGCGGAGTAAAGAAGACTGCAGGATATAGTAGTGTAGTTGGAG
TAGAGGGAGTTCATAGCTTTGTTGCTGCAGAGAAGCAGAACCATCCAAGATGGACGGAGATAAAAAGAATATTGCAGCAT
CTGCATAACGAAATGAAGTCAAAAATTGGATCGTTGGACTTGTTAGGAACATAG