Details for Lyrate rockcress Locus 16039062

Position : sca3 ( 5`- 1154159 .. 1151763 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477611 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039062

Protein [Map View]
MDQEQTPQSPTGHSRSPSSSASGSTSAEPVRSRWSPKPEQILILESIFHSGMVNPPKEETVRIRKMLEKFGAVGDANVFY
WFQNRRSRSRRRQRQLQAAAAAAAATTNTCDQTMMVSNSLPHHSGSDLGLGGCSTSSNYLFASSSSSYGGGCDNQSNSGM
ENLLTMSGQMSYHEVNHHHYQNHSSNVASILCPSDQNSNFHYQQGAITVFINGVPTEVTRGGIDIKATFGEDLVLVHSSG
VPLPTDEFGFLMHSLQHGEAYFLVPRQI*

DNA
ATGGACCAAGAACAAACCCCACAGAGCCCAACCGGCCATAGTCGTTCACCCTCATCCTCGGCCTCCGGTTCCACCTCAGC
AGAACCGGTTCGGTCACGATGGTCACCTAAACCGGAACAAATACTCATACTTGAGTCGATCTTCCACAGTGGTATGGTTA
ACCCTCCCAAAGAAGAGACGGTAAGAATAAGAAAGATGCTCGAGAAATTTGGCGCGGTGGGAGATGCAAATGTCTTTTAT
TGGTTTCAAAACCGGCGGTCAAGATCCCGTCGGAGACAGCGACAGCTCCAGGCCGCAGCTGCAGCCGCGGCCGCAACCAC
CAACACTTGTGACCAGACCATGATGGTGAGCAACAGCTTACCACATCATAGTGGGAGTGATTTGGGGTTGGGAGGGTGTA
GCACTTCTTCTAATTACTTATTTGCTAGCTCTTCCTCTTCTTATGGTGGTGGATGTGATAATCAAAGCAATAGTGGCATG
GAGAATCTCTTAACAATGTCAGGCCAAATGAGTTATCATGAAGTTAATCATCATCATTACCAAAATCATAGCTCAAATGT
CGCATCGATTTTGTGCCCATCTGATCAAAACTCCAATTTTCACTACCAACAAGGGGCTATAACGGTGTTTATCAACGGAG
TTCCGACAGAAGTGACGAGAGGAGGAATAGACATAAAAGCAACGTTTGGAGAAGATTTGGTTTTGGTGCATTCCTCAGGT
GTTCCTCTTCCTACTGATGAGTTTGGTTTTTTGATGCATAGCTTACAACATGGTGAAGCTTATTTCCTGGTTCCAAGACA
GATATGA