Details for Lyrate rockcress Locus 16039047

Position : sca3 ( 5`- 7271901 .. 7270443 -3` )
Annotation : [B2G] pectinesterase family protein
External links : CoGe
PGDD synteny : 16039047

Protein [Map View]
MDHITRMILVLTLVVMSVWGSDASAMQKTKFDAPLLTEKIATNRSIIVDIEGKGDYTSVQKAIDAVPVGNSNWIIVHVRK
GIYKERVHIPENKPFIFMRGNGKGKTVIESSQSSVDNVASATFKVEANHFVAFGISIRNDAPIGMAFTSENQSVAAFVAA
DKVAFYHCAFYSLHNTLFDNKGRHYYHECYIQGSIDFIFGRATSIFNNCEIFVISDKRVKPYGSITAHHRENAEENTGYV
FIRGKVYGIDEVYLGRAKGPYSRVIFAKTYLSKTVVPDGWTNWSYHGSTENLYHGEYKCHGPGAERQKRSDWAKELTKQE
VESFLSIDFIDGTSWLPVWLQQKS*

DNA
ATGGATCATATAACAAGAATGATCCTTGTCCTAACCCTAGTTGTAATGTCCGTATGGGGTTCGGACGCATCAGCAATGCA
AAAGACGAAATTCGACGCACCGCTTCTAACTGAAAAAATCGCAACAAATAGATCGATAATTGTTGATATCGAAGGCAAAG
GAGACTACACTTCGGTTCAAAAAGCCATCGATGCTGTCCCTGTTGGTAACTCCAATTGGATCATCGTCCATGTCCGTAAA
GGAATCTACAAGGAGAGGGTGCACATTCCGGAGAATAAGCCGTTCATATTCATGAGGGGTAATGGAAAAGGAAAGACGGT
GATCGAATCTTCGCAAAGTTCGGTTGACAATGTTGCTTCAGCCACTTTCAAAGTCGAAGCTAATCACTTTGTCGCTTTTG
GTATCAGCATCAGAAATGATGCACCAATCGGAATGGCATTCACGTCGGAGAACCAATCGGTGGCAGCGTTTGTGGCTGCT
GACAAAGTAGCATTTTACCATTGTGCGTTCTACAGCTTACACAACACTTTGTTTGATAACAAAGGTAGACATTACTACCA
TGAGTGTTACATCCAAGGCTCCATCGACTTCATCTTCGGTCGCGCAACTTCCATTTTCAACAATTGTGAGATATTTGTGA
TATCGGACAAGAGGGTGAAACCGTACGGATCAATCACAGCACACCATAGGGAAAACGCAGAGGAAAATACTGGTTACGTG
TTCATAAGAGGCAAAGTGTACGGAATTGATGAGGTTTACTTGGGCCGAGCCAAAGGACCTTATTCCCGAGTCATCTTTGC
CAAGACTTACTTGTCCAAGACCGTTGTGCCTGATGGTTGGACCAACTGGAGTTACCACGGCTCAACCGAGAATTTATACC
ATGGGGAGTATAAATGTCATGGACCAGGAGCTGAGAGGCAAAAAAGATCTGATTGGGCCAAAGAGCTAACTAAACAAGAA
GTTGAGTCTTTCTTGTCCATTGATTTTATTGATGGCACTTCTTGGCTCCCTGTTTGGCTTCAGCAAAAGTCTTAG