Details for Lyrate rockcress Locus 16039027

Position : sca3 ( 5`- 5960854 .. 5962778 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478846 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16039027

Protein [Map View]
MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDDHIGCAMSG
LIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTF
WQCNAKAIGSGSEGADSSLQEQFNKDITLQEAETIAVSILKQVMEEKVTPNNVDIAKVAPAYHLYTPQEVEAVISRL*

DNA
ATGTTTCTCACTAGGACTGAGTATGACAGAGGAGTCAATACTTTTTCTCCTGAAGGTCGTCTCTTTCAGGTTGAGTATGC
CATTGAGGCTATCAAGCTTGGTTCTACTGCTATTGGCGTAAAGACGAAAGAGGGGGTTGTTCTTGCAGTCGAGAAGCGTA
TTACTTCGCCTTTGCTGGAACCGAGCAGTGTTGAGAAGATTATGGAAATTGATGACCATATAGGTTGTGCCATGAGTGGT
CTGATTGCTGATGCGCGAACACTTGTTGAGCATGCACGAGTAGAGACCCAAAACCACAGGTTCTCGTATGGTGAGCCAAT
GACTGTAGAATCTACAACACAAGCTTTGTGTGATCTTGCTTTACGGTTTGGTGAAGGAGATGAAGAGTCAATGTCTCGTC
CATTTGGAGTATCCCTTCTCATTGCCGGGCATGATGAAAATGGACCGAGCCTGTACTACACAGATCCATCGGGAACATTC
TGGCAATGCAACGCAAAGGCAATTGGGTCAGGCTCAGAAGGAGCTGATAGTTCTCTCCAAGAGCAATTCAACAAGGATAT
AACTCTTCAAGAAGCTGAAACAATCGCTGTATCTATCCTAAAGCAAGTAATGGAAGAAAAGGTGACTCCAAACAATGTCG
ACATTGCCAAAGTAGCACCCGCATATCACCTCTACACTCCTCAGGAGGTTGAAGCCGTCATCAGTCGTCTATGA