Details for Lyrate rockcress Locus 16039009

Position : sca3 ( 5`- 6359055 .. 6359714 -3` )
Annotation : [B2G] aterf-4 aterf4 erf4
External links : CoGe
PGDD synteny : 16039009

Protein [Map View]
MAKMGLKPDPATTNPTNNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAYDTAARDFRGAKAKTNF
PTFLELSDQKVPTGFARSPSQSSTLDCASPPTVVVPSATAGNVPPQLELSLGGGACYQIPMARPVYFLDLMGIGNVGRGQ
PPPVTSAFRSSVVHVPTKMTCGAQSDSDSSSVVDFEGGMEKRSQPFDLDLNLPPPSEQA*

DNA
ATGGCTAAGATGGGCTTGAAACCCGACCCGGCTACTACAAACCCGACCAACAATAATGCCAAGGAGATTCGTTACAGAGG
CGTTAGGAAGCGTCCTTGGGGCCGTTATGCCGCCGAGATCCGAGATCCAGGCAAGAAAACCCGCGTCTGGCTTGGTACTT
TCGATACGGCTGAAGAGGCGGCGCGTGCTTATGATACGGCGGCGCGTGATTTTCGTGGAGCTAAGGCTAAGACAAATTTC
CCGACTTTTCTCGAGCTGAGTGATCAGAAGGTGCCTACCGGTTTCGCGCGTAGCCCTAGCCAGAGCAGCACGCTTGACTG
TGCTTCTCCTCCGACGGTGGTTGTGCCATCAGCGACGGCTGGGAATGTTCCGCCGCAGCTCGAGCTTAGCCTCGGGGGAG
GCGCGTGTTATCAGATCCCGATGGCGCGTCCTGTCTACTTTTTGGACCTGATGGGAATCGGAAACGTTGGTCGTGGTCAG
CCTCCTCCTGTGACATCGGCGTTTAGATCGTCGGTGGTGCATGTTCCGACGAAGATGACTTGTGGGGCCCAGAGCGACTC
TGATTCGTCTTCCGTCGTTGATTTCGAAGGTGGAATGGAGAAAAGATCTCAGCCATTCGATCTAGATCTAAACTTGCCTC
CCCCGTCGGAACAAGCCTGA