Details for Lyrate rockcress Locus 16038976

Position : sca5 ( 5`- 17869922 .. 17871719 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038976

Protein [Map View]
MAEMHQNPAAETIPGTPVIREVRTGSGSQNFNPESTRRGGLRAEIDIYSPLFGGRGSRVPFNLGNNYDGVGDFDIKRMKE
QTVELEKDLIMKELETLDLLEALGSTKSIVEDLKWQLQQQALRCKETPQHLRSHIKEMIDERSPDLTLLELKQASMNIGK
TMDDLALIQSYSESLNIKTKEEKDVFGVVSLAEELNSLRFNPAGPDEGERFNTENLLVNPQCEQIKMVVETNDTAFHKQS
KTCLRTAEMRLVAARKMEEAARAAEAFAIAEMTILSSVKNEDTFCFPEPPCFPLTLKAQMNKELSANVSRIEILRKLEEA
NEEVKQSKKALEMALNRVEVANTKQLEAQDAFRQWNIESWKDQKAVGAKHSMKRDSFPQRSFLSHVNQHEPLIDLLEPML
KRNVSMGNNVLNRKDEKQLVTPRRKFRFIQTHQDSIGETE*

DNA
ATGGCGGAGATGCATCAAAACCCTGCGGCGGAGACGATTCCCGGTACACCCGTAATCCGGGAGGTGAGAACCGGATCCGG
GTCCCAGAATTTCAACCCGGAGAGTACAAGGAGAGGAGGACTGAGAGCTGAAATCGACATTTATTCACCGTTATTTGGTG
GTCGTGGGTCTCGGGTTCCGTTCAATCTTGGAAACAACTACGACGGTGTGGGAGATTTTGACATAAAGAGGATGAAAGAA
CAGACAGTGGAGCTTGAGAAGGATCTGATTATGAAAGAGTTAGAAACACTAGATCTTCTTGAAGCTCTTGGATCAACCAA
AAGCATTGTTGAAGATTTGAAGTGGCAGCTCCAGCAACAAGCACTTAGATGCAAGGAGACCCCTCAACATTTGCGTTCAC
ACATCAAAGAGATGATCGATGAACGCTCGCCAGATCTGACCCTCTTGGAATTGAAGCAAGCAAGTATGAATATTGGTAAA
ACCATGGATGATCTTGCGTTAATCCAATCCTATTCTGAATCTCTGAATATAAAAACGAAGGAAGAGAAAGATGTCTTTGG
AGTAGTGTCTCTAGCTGAGGAGCTTAACAGTTTGAGGTTTAACCCAGCAGGTCCTGATGAAGGAGAGAGGTTCAATACCG
AGAATTTACTTGTGAACCCACAATGTGAACAGATTAAGATGGTAGTTGAAACCAATGATACAGCTTTTCATAAACAGAGC
AAGACTTGCCTGAGAACTGCAGAAATGAGATTGGTTGCTGCAAGAAAAATGGAAGAGGCTGCACGAGCAGCGGAAGCATT
TGCGATTGCTGAAATGACCATATTATCCAGCGTAAAAAACGAAGACACATTCTGCTTCCCGGAGCCACCATGTTTTCCAT
TAACACTTAAAGCACAGATGAACAAAGAATTATCCGCCAATGTCTCAAGAATAGAGATCTTGAGGAAGCTGGAGGAAGCT
AATGAAGAAGTTAAACAAAGTAAAAAAGCTTTGGAGATGGCGTTAAACCGGGTAGAAGTCGCCAATACGAAGCAACTTGA
AGCACAAGATGCGTTTCGCCAATGGAACATAGAGTCATGGAAAGACCAGAAAGCTGTTGGAGCAAAACACTCGATGAAAA
GAGACAGCTTTCCTCAACGCTCCTTCTTGAGCCATGTGAATCAGCACGAGCCACTGATCGATCTCCTTGAGCCAATGCTG
AAACGTAACGTCTCAATGGGTAATAATGTTCTTAACCGAAAAGACGAGAAACAGTTGGTCACGCCGAGAAGAAAGTTTAG
GTTCATACAAACACATCAAGATTCCATTGGAGAAACAGAGTAA