Details for Lyrate rockcress Locus 16038807

Position : sca5 ( 5`- 17865825 .. 17867518 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038807

Protein [Map View]
MEAPRSVGGRIQRKPLADCTNTVSRSSQQSSSSVKFANPSLTSSLKRIVEQTTLKEKPKDVITSETTSESASRSLATNVR
PVTRRMSADLGSPASAPSRPQTSRSDMGVSDKDDFAEPWSVYTVRRKASGQKRSKDASSSTSAAARLRLDLTSSSRKKTH
QASENKKKTTLKVAPKKRQRTLKPEKKDPVNAACQDYIEKQKAYFAEIDAFELPIEEVSNSDSD*

DNA
ATGGAAGCTCCTCGCTCCGTCGGAGGAAGAATACAGAGGAAACCGCTCGCGGATTGTACCAACACCGTCTCCAGATCTTC
TCAACAGTCATCTTCTTCAGTCAAATTCGCGAATCCGAGTCTCACTTCTTCACTTAAGAGGATAGTAGAACAAACTACGC
TCAAGGAGAAACCCAAAGATGTTATTACTTCAGAGACTACTTCTGAGAGCGCTTCTCGGTCTCTTGCCACGAACGTTAGA
CCCGTAACTCGCCGTATGTCTGCCGATCTGGGTTCTCCGGCCTCTGCTCCTTCTCGTCCCCAAACATCGCGATCTGATAT
GGGCGTTAGTGACAAGGATGATTTTGCTGAGCCTTGGTCTGTTTACACGGTAAGAAGGAAGGCCTCTGGACAAAAAAGGA
GTAAAGACGCTTCTTCCTCTACTAGTGCAGCAGCTCGCCTTCGTCTCGACTTGACATCAAGCTCTCGGAAGAAAACACAT
CAAGCAAGTGAAAACAAAAAGAAGACGACCTTGAAAGTGGCTCCAAAAAAGAGACAGCGGACGTTAAAGCCAGAGAAAAA
GGATCCGGTTAATGCAGCTTGTCAGGATTATATCGAGAAGCAGAAAGCTTATTTTGCAGAGATTGATGCATTTGAGCTGC
CCATAGAAGAGGTATCTAATAGCGACTCAGACTAA