Details for Lyrate rockcress Locus 16038781

Position : sca1 ( 5`- 7634897 .. 7636724 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_889231 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16038781

Protein [Map View]
MVKVIDSHYLAITAIVTVGYQLIFFVITALFKFDQVTDFAGSTNFVILAVLTLVLKGTWHYRQIVLTVLVVVWGLRLGLF
LLMRILQWGEDRRFDEMRGNIGKLVVFWIFQAVWVWTVSLPVTFVNASNGGRLFQPADVIGWTMWVAGFLIEATADQQKL
SFNKCPENKGRWCDVGVWKYSRHPNYFGEMLLWWGIYVASLPVLKGVEYLVIIGPVFLTLLLFFVSGIPLLEESADKKYG
NLGAYRHYKKTTSPLILLPRGVYGYLPKWCKTVFLFEFPLYSRNLPQETTAWDRRNSKKSQRSID*

DNA
ATGGTGAAAGTAATCGATTCCCATTACCTAGCCATCACCGCCATTGTCACCGTGGGTTATCAATTGATATTCTTCGTAAT
CACAGCTCTTTTCAAATTTGATCAAGTTACAGACTTTGCCGGAAGTACTAATTTCGTGATACTTGCTGTCTTGACTCTGG
TTCTCAAAGGGACATGGCATTATCGTCAGATAGTCTTGACTGTACTAGTAGTCGTATGGGGACTTCGTCTCGGACTGTTC
CTCCTTATGAGGATCTTGCAATGGGGTGAAGATCGACGCTTTGATGAAATGCGTGGAAATATCGGGAAACTAGTAGTCTT
TTGGATTTTTCAGGCCGTGTGGGTTTGGACTGTTAGTTTACCTGTTACCTTTGTTAATGCAAGCAACGGTGGAAGATTGT
TTCAGCCCGCAGATGTTATAGGTTGGACAATGTGGGTTGCAGGGTTCTTGATTGAAGCTACAGCTGATCAACAAAAACTT
TCATTCAACAAGTGTCCAGAAAACAAAGGAAGATGGTGCGATGTTGGTGTATGGAAGTATTCACGCCATCCAAACTACTT
TGGTGAGATGTTACTCTGGTGGGGCATATATGTGGCTTCATTGCCTGTGCTTAAAGGTGTCGAGTACCTTGTCATAATTG
GACCAGTCTTTCTCACTTTGCTACTTTTCTTCGTTAGCGGCATACCATTACTCGAGGAATCTGCGGACAAAAAATATGGT
AACTTGGGAGCTTATCGACACTACAAGAAGACAACTAGTCCTTTGATTCTGTTACCACGAGGAGTGTATGGGTACTTGCC
AAAATGGTGCAAAACAGTCTTTCTTTTTGAGTTTCCATTGTATAGCCGTAATCTTCCTCAAGAGACTACAGCCTGGGATA
GACGAAACTCGAAGAAGAGCCAGAGAAGTATTGACTGA