Details for Lyrate rockcress Locus 16038754

Position : sca3 ( 5`- 4160687 .. 4159534 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038754

Protein [Map View]
MSISSLGSAISRPTSSSSSYTYLVSCSRIFGLATSSLLWTKNKPHHTNTKLKQQKPCVRNSAQEIPQTLEEDSKFVPLDP
QDPRFGPPVLLLLGLQLHEAQKIQELLKELDGEFMEIVFCTEDMIPRSLWEAVNTKQPDLNRVNVAKSLPRICFLSGLTG
EEMMMFIDAFPETGLEPVVFAAMVPNSADKPIFELIEEIMGDHELLTGSGSS*

DNA
ATGTCGATTTCTTCGTTGGGGTCTGCAATCTCAAGGCCAACTTCTTCATCATCTTCATATACGTACTTAGTAAGCTGTTC
TCGCATCTTTGGCCTCGCTACCTCTTCTTTGTTATGGACAAAGAACAAACCTCACCACACAAACACAAAGCTTAAGCAGC
AAAAGCCATGTGTTAGAAATTCAGCTCAAGAGATTCCACAGACACTTGAGGAAGACTCCAAGTTTGTACCTTTAGATCCT
CAAGATCCTCGATTCGGCCCTCCAGTTTTGCTGTTGCTTGGCCTTCAACTTCATGAAGCACAAAAGATACAGGAGCTTCT
GAAGGAACTTGATGGCGAATTCATGGAGATTGTTTTCTGTACAGAAGATATGATCCCACGCTCGTTATGGGAAGCAGTTA
ACACAAAACAGCCTGACCTGAACAGAGTGAATGTCGCGAAGTCGCTGCCTCGGATCTGCTTTTTATCTGGTTTGACAGGA
GAGGAGATGATGATGTTCATTGATGCATTTCCAGAAACTGGGCTGGAACCAGTTGTGTTTGCAGCTATGGTTCCGAACAG
TGCTGATAAACCTATCTTTGAGTTAATTGAAGAAATCATGGGAGATCATGAGTTATTGACCGGGAGCGGTTCCAGCTGA