Details for Lyrate rockcress Locus 16038727

Position : sca3 ( 5`- 985227 .. 984233 -3` )
Annotation : [B2G] universal stress protein family protein
External links : CoGe
PGDD synteny : 16038727

Protein [Map View]
MGKARTVGVGMDYSPTSKLALRWAAENLLEDGDTVILIHVQPQNADHTRKILFEDTGSPLVPLEEFREINLSKQYGLAYD
PEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRILLGSVSNHVVTNATCPVTVVKAN*

DNA
ATGGGAAAGGCACGTACAGTGGGAGTGGGAATGGACTATTCTCCGACGAGCAAATTAGCTCTCCGGTGGGCGGCGGAGAA
TCTCCTTGAAGACGGCGACACCGTCATCTTGATTCACGTCCAACCGCAAAACGCCGATCATACCCGCAAAATCCTCTTCG
AGGACACCGGTTCACCGCTAGTTCCTTTGGAGGAATTTAGAGAGATTAATTTGTCTAAACAGTATGGACTTGCTTACGAT
CCTGAGGTTCTTGATGTTCTTGATACTCTCTCTAGGGCTAAAAAGGTGAAGGTTGTGGCAAAGGTGTATTGGGGAGATCC
AAGAGAGAAACTTTGTGATGCTGTCGAAAATCTTAAACTCGATTCCATTGTTCTTGGCAGTCGAGGTTTGGGTTCTCTCA
AAAGGATCTTGCTAGGTAGTGTGAGCAATCATGTGGTGACAAATGCAACATGTCCAGTCACAGTTGTTAAGGCTAATTAA