Details for Lyrate rockcress Locus 16038707

Position : sca3 ( 5`- 2031030 .. 2031655 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038707

Protein [Map View]
MSLKPYFSLHSSPTNARFSNFLIAQQPSGDRKTTPAEEFSPLVEKFNRRLLLGVGSSSVLAVGANFGGITSFVLGLSPEV
GRNLKLDVVYPIGGYSRCIDTVEGFEFIYPATWVGDQTLLYRAAEKSERENSLDLPPARNSRRKNVNEPVVAFGPPGSTG
ELNVSVIVSPVSPSFS*

DNA
ATGTCTCTGAAACCTTACTTCTCTCTACACTCATCACCCACAAATGCAAGATTTTCCAACTTTTTGATTGCTCAACAACC
CTCCGGTGACCGGAAAACTACCCCGGCGGAGGAGTTTTCTCCGCTGGTTGAGAAATTCAACCGGCGGCTTCTTCTGGGTG
TAGGATCTTCCTCTGTTCTTGCGGTTGGTGCGAATTTCGGAGGAATCACGAGTTTCGTACTTGGTTTATCGCCGGAAGTT
GGCCGTAATCTGAAACTCGACGTCGTTTATCCGATTGGAGGATATAGCAGATGTATCGATACGGTTGAAGGATTCGAATT
TATATATCCGGCTACGTGGGTCGGAGACCAGACACTTTTGTATAGAGCGGCGGAGAAATCAGAACGGGAGAATTCGCTAG
ACCTTCCTCCGGCAAGAAACAGTCGTCGGAAAAACGTTAATGAACCGGTTGTTGCATTTGGACCTCCCGGTTCGACCGGC
GAGCTCAATGTCAGTGTTATCGTCTCCCCTGTCTCTCCCAGTTTCTCGTAA