Details for Lyrate rockcress Locus 16038662

Position : sca3 ( 5`- 7376866 .. 7377912 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038662

Protein [Map View]
MPSLQTSLPPELANNVVRLYRECLRRAKFIGKQQHNTELVVGMVRQQFKKHMNETDPEKIQKLKDDAARGLINHMLFESA
KLTGGKVSQRS*

DNA
ATGCCGTCTTTGCAAACTTCTCTGCCTCCTGAACTCGCTAACAATGTGGTTAGGTTGTACCGAGAATGTCTTCGTAGAGC
TAAATTTATTGGTAAGCAGCAACACAACACTGAGCTAGTGGTTGGTATGGTGAGGCAACAATTTAAGAAACACATGAATG
AGACAGACCCTGAGAAGATTCAGAAGCTTAAAGATGATGCTGCTCGGGGACTCATCAATCACATGTTGTTTGAGTCAGCA
AAGCTGACAGGAGGCAAGGTTAGCCAGAGATCCTGA