Details for Lyrate rockcress Locus 16038648

Position : sca3 ( 5`- 7502892 .. 7503134 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16038648

Protein [Map View]
MASWKKTIATPFKKAATFFNQPQQSPKKGCRGRMDAKAREEHEKRMVQELQGEVMACGYDDVLVMWSILDKSNSSNNLSC
*

DNA
ATGGCATCATGGAAGAAAACAATCGCAACACCATTCAAGAAAGCGGCAACATTCTTCAACCAACCGCAACAATCACCAAA
GAAGGGTTGTCGTGGAAGAATGGATGCGAAAGCAAGGGAAGAGCACGAGAAGAGAATGGTTCAAGAGCTCCAAGGAGAAG
TCATGGCTTGTGGTTACGACGACGTCCTCGTCATGTGGTCTATTCTTGACAAATCTAACTCCTCAAATAACCTCTCTTGT
TAA