Details for Lyrate rockcress Locus 16038645

Position : sca3 ( 5`- 2913320 .. 2909575 -3` )
Annotation : [B2G] arginine n-methyltransferase family protein
External links : CoGe
PGDD synteny : 16038645

Protein [Map View]
MEVSSVKKLEQLEFSLDSVTDLSASSASSSTPAVATFSCVDGVTELRFLQSDSTHCFNFDLASAQLFKLGPVHFICVSDS
SEEKSFSKGVNIKFKNDKDSNDFCESFQEWRKDAVVQGSSLQNGTVSANKSKFDNKIEASSAKMYFHYYGQLLHQQNMLQ
DYVRTGTYYAAVMENRSDFAGRVVVDVGAGSGILSMFAAQAGAKHVYAVEASEMAEYSRKLIAGNPLFAERITVIKGKVE
DIELPEKADILISEPMGTLLVNERMLESYVIARDRFMSPKGKMFPTVGRIHMAPFSDEFLFIEMANKAMFWQQQNYYGVD
LTPLYGSAHQGYFSQPVVDAFDPRLLVASPMFHMIDFTQMKEEDFYEIDIPLKFTASMCTRVHGLACWFDVLFDGSTVQR
WLTTAPGAPTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQSSTCKFDLKEPY
YRMSQPQAYPVTQEPPLQPQPELNTQDIQTPNDELEEELLQQLPQNLSAQL*

DNA
ATGGAGGTGTCTTCTGTGAAAAAGCTTGAGCAGCTGGAGTTCTCTTTAGACTCGGTCACTGATCTCTCTGCCTCTTCCGC
TTCGTCGTCCACTCCAGCTGTAGCTACGTTTTCCTGCGTTGATGGAGTCACGGAGCTCCGATTTCTGCAATCGGATTCGA
CCCATTGTTTCAATTTTGATCTCGCTTCCGCTCAGTTATTCAAGTTGGGGCCAGTGCATTTCATCTGTGTATCTGATAGT
TCAGAGGAGAAATCATTCTCCAAAGGAGTCAATATAAAATTTAAAAATGACAAGGATAGCAATGATTTTTGTGAGTCCTT
TCAAGAGTGGAGAAAGGATGCTGTTGTTCAAGGATCATCCTTGCAAAATGGAACGGTTTCAGCTAATAAAAGCAAGTTCG
ACAATAAGATAGAGGCGTCATCAGCCAAAATGTATTTCCATTATTATGGACAACTTCTACATCAACAAAATATGCTACAA
GATTATGTGAGGACAGGTACATATTATGCCGCAGTCATGGAGAATCGTTCAGATTTTGCTGGTCGTGTTGTGGTCGATGT
GGGTGCAGGGAGTGGCATTTTGTCAATGTTTGCTGCCCAGGCTGGTGCCAAACATGTGTATGCGGTTGAAGCATCAGAAA
TGGCTGAGTATTCTCGTAAGCTGATTGCTGGAAACCCATTATTCGCTGAACGGATCACAGTCATCAAGGGTAAAGTTGAG
GATATCGAGTTGCCTGAGAAAGCAGATATTTTGATCTCTGAACCGATGGGCACCTTACTGGTCAACGAGAGAATGTTAGA
ATCGTATGTAATTGCTAGGGATCGTTTTATGTCTCCAAAGGGCAAAATGTTTCCCACTGTCGGAAGGATTCACATGGCAC
CTTTTTCTGATGAATTCTTATTTATTGAGATGGCAAATAAGGCTATGTTTTGGCAACAGCAGAACTATTATGGAGTTGAT
CTGACACCTCTATATGGATCAGCACACCAAGGTTATTTTTCTCAGCCCGTGGTTGATGCATTTGATCCGAGATTATTAGT
GGCTTCTCCGATGTTTCACATGATAGATTTCACTCAAATGAAGGAAGAAGATTTTTACGAGATTGATATCCCGTTGAAGT
TCACTGCTTCCATGTGCACCAGAGTGCATGGACTTGCCTGCTGGTTCGACGTTCTCTTCGACGGGAGCACGGTCCAAAGA
TGGCTCACAACTGCTCCTGGTGCACCTACAACGCATTGGTACCAAATCAGATGTGTTCTCTCACAGCCTATTTACGTAAT
GGCAGGTCAAGAGATCACTGGTAGACTTCATTTGATAGCCCACAGTGCTCAGAGTTATACCATAGATTTAACTTTATCAG
CTAAAATGTGGGGTCCCGGTGCAAGTCAAGGTGGAATTCTCCAATCATCGACATGCAAATTCGATCTGAAAGAACCTTAT
TATAGAATGTCTCAGCCACAAGCATACCCTGTTACACAAGAACCACCTCTACAACCACAACCAGAGCTAAATACACAGGA
CATACAAACACCAAACGATGAATTAGAAGAAGAGTTACTGCAACAACTGCCACAGAACCTGAGTGCCCAGCTCTAA